KEGG   Sediminicola sp. YIK13: SB49_02075Help
Entry
SB49_02075        CDS       T04145                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
syi  Sediminicola sp. YIK13
Pathway
syi00790  Folate biosynthesis
syi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SB49_02075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syi04147]
    SB49_02075
Enzymes [BR:syi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     SB49_02075
Exosome [BR:syi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SB49_02075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a ENTH
Motif
Other DBs
NCBI-ProteinID: ALM06728
UniProt: A0A0S1S8G4
Position
complement(443806..444093)
Genome map
AA seq 95 aa AA seqDB search
MKKLTTEEINERLDQLDGWDYTEKAIQTTFEFADFKETFSIMTRIAFECEAQNHHPEWTN
VYKTLTIRLSTHDADGVTEKDFKLAATIENIIESE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgacaacagaggaaataaacgaacgattagaccaattggacggctgggat
tataccgaaaaggccatacagaccaccttcgaatttgccgacttcaaggagaccttctcc
attatgacacgaatcgcctttgagtgcgaagcccaaaaccaccatccggaatggaccaat
gtttacaagaccttaaccattagattaagtacgcatgacgcggacggggttaccgaaaag
gatttcaagcttgcggctaccatagaaaatatcatagaaagcgaataa

DBGET integrated database retrieval system