KEGG   Sediminicola sp. YIK13: SB49_04140Help
Entry
SB49_04140        CDS       T04145                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
syi  Sediminicola sp. YIK13
Pathway
syi00361  Chlorocyclohexane and chlorobenzene degradation
syi00625  Chloroalkane and chloroalkene degradation
syi01100  Metabolic pathways
syi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SB49_04140
   00361 Chlorocyclohexane and chlorobenzene degradation
    SB49_04140
Enzymes [BR:syi01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SB49_04140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ALM09160
UniProt: A0A0S1SFF3
Position
complement(939576..940244)
Genome map
AA seq 222 aa AA seqDB search
MHSKPRLLIFDVNETLLDLKPMKVAINNALANELAFDNWFSSLLHYSLVESISGKYQDFG
KVGAATLKMTAEKFEKQISESKIKDVLSLIKKLPPHPDVVQGLTILKNSGVKMVALTNGT
MEVVKAQMAFAEIDHFFDELFSVENVKQYKPHPLTYTHVVKEMKASPIYSMLIAAHGWDI
AGAQRAGLMTAFVSRPGKFPYPLAEEADITGSNILSIAKSLV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcactccaaaccaaggttgctcatttttgatgttaatgaaacgctattggatttaaaa
ccgatgaaagtggccattaacaatgccttggcaaatgaacttgcctttgataactggttt
tcctctcttttgcactactcactggtcgaatctatttcagggaagtaccaagattttgga
aaagtaggagcagcaacgcttaaaatgacagcagaaaaatttgaaaagcaaatctctgag
agcaaaattaaggatgttctaagtttgataaaaaaattacccccacatcccgatgttgtg
caaggacttaccatacttaaaaatagcggggtaaaaatggtcgccttgaccaatggcaca
atggaggttgtgaaagcccaaatggcatttgcagaaattgaccacttctttgatgaactt
tttagtgtggagaatgtgaaacagtacaagccacatcctttaacctatacccatgtggta
aaggaaatgaaagcttcgccaatttattccatgctgattgccgcccatggatgggacatt
gcgggtgcccaaagagccggactaatgactgcttttgtttcaaggcccggaaaattccca
tatcctttggcagaagaagccgatattaccggaagtaacattctatcaatagcaaagtcc
ttggtttaa

DBGET integrated database retrieval system