KEGG   Sediminicola sp. YIK13: SB49_11440Help
Entry
SB49_11440        CDS       T04145                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
syi  Sediminicola sp. YIK13
Pathway
syi00350  Tyrosine metabolism
syi00360  Phenylalanine metabolism
syi00380  Tryptophan metabolism
syi01100  Metabolic pathways
syi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SB49_11440
   00360 Phenylalanine metabolism
    SB49_11440
   00380 Tryptophan metabolism
    SB49_11440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syi04147]
    SB49_11440
Enzymes [BR:syi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     SB49_11440
    4.1.1.105  L-tryptophan decarboxylase
     SB49_11440
Exosome [BR:syi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SB49_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Aminotran_1_2 SepSecS DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ALM08352
UniProt: A0A0S1SEL4
Position
complement(2566217..2567644)
Genome map
AA seq 475 aa AA seqDB search
MNSDEFRKQAHLMVDWMADYLEHVEDYPVKSQVAPRTIYDQINSAIPKLGEDMEHIFNDF
KEIIIPGITHWQNPNFFAYFQANTSPPSILAEMLTATLGVQGMKWETSPAATELEERMME
WLGDGIGIPKLWAGVIQDSASMATLSAILTARERLSKYQINEKGFEGYTKLRVYCSDQTH
SSIEKGAKIAGVGKSNVIKIPTNDQLEMRSDLLRQQIESDIKQGYQPLCIVAALGTTGTM
AMDPLEEIGMLAEKHNIWLHVDAAYAGAAFLLPEHQSLMKGIEKADSFVFNPHKWLFTNY
DCTAFFVKDKKGLLNTFSILPEYLKTASDGLVNNYCDWGIPLGRRFRSLKLWFVMRHYGL
EGLQKMLRLHIALAEWLEAELKKKPTFEMVVPRSMNLICFRYMPEGVEDQEQLNTINEQL
LQSLNASGELYLTHTKIDGKYTLRMSIGQTNVTQTHLENAWKNIQELAHGIVINE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaactcggacgaatttcgcaaacaagcccatcttatggtagattggatggcagattat
ttggagcatgtggaagactaccccgtaaaatcacaggtagcgccaagaacaatctatgac
cagattaattcagctatcccaaagctaggcgaggacatggaacatatttttaatgatttc
aaagagatcataatacctggaattacgcactggcagaaccccaactttttcgcctacttt
caggccaatacgagtccgccttccatcctggcagaaatgttgaccgcaaccttgggagtc
caggggatgaagtgggaaacctccccggcagccacggaattggaggagaggatgatggaa
tggttgggagacggtatagggatacccaaactatgggcgggggtgatccaagattctgca
tccatggcgacattatctgcaatccttacagccagagagcgactttccaaatatcagatc
aatgaaaagggatttgaggggtacaccaaattacgggtgtactgctcggaccagacccat
tcctccatagaaaagggagctaaaatagccggagtagggaaaagtaatgtgatcaagatc
cccaccaacgaccaattggaaatgcgctccgatcttctaaggcaacaaatagaaagtgat
atcaagcagggctaccaacccctttgtattgttgctgccttagggacaacaggtaccatg
gccatggatcccttggaagaaataggaatgctggctgaaaagcacaacatttggttgcac
gtagatgcggcctatgccggagccgcctttttgctcccggaacaccagagcctgatgaaa
gggattgaaaaagcggatagttttgtttttaacccacataaatggctctttaccaattat
gattgtacggccttttttgtaaaggacaagaaggggctcctgaataccttttctatcttg
ccggaatatttgaaaacggcttcagacggactggtgaacaattattgcgattggggcatt
cccctgggaaggcgtttcaggtctttgaaattatggtttgtgatgcggcattacgggctt
gaggggctacaaaagatgctgcgattgcatatagcattagcagaatggctggaggccgag
ctaaaaaagaagcctacatttgaaatggtggtgccccgtagtatgaacctgatctgtttt
agatacatgccagagggagtagaagaccaagaacaacttaataccattaatgagcaattg
ctgcaaagtttgaatgcctcgggcgaactctatctgacacataccaagattgatgggaaa
tatacccttcgcatgtccattgggcagaccaatgtgacgcaaacccatttggaaaatgct
tggaaaaacattcaagaattggctcatggtatagtaattaatgagtga

DBGET integrated database retrieval system