KEGG   Sediminicola sp. YIK13: SB49_12215Help
Entry
SB49_12215        CDS       T04145                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
syi  Sediminicola sp. YIK13
Pathway
syi00480  Glutathione metabolism
syi00590  Arachidonic acid metabolism
syi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SB49_12215
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SB49_12215
Enzymes [BR:syi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SB49_12215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA RuvX
Motif
Other DBs
NCBI-ProteinID: ALM08489
UniProt: A0A0S1SD71
Position
2747383..2747931
Genome map
AA seq 182 aa AA seqDB search
MHPLKSLAKKLVMNTSPMDINIPKESPSVYTVKLNALNGNPIHLENFKGKKVLLVNVASK
CGYTKQYRPLQKLQDTYKDQLVVIGCPCNQFGSQEPGNAEQIQKFCELNYGVDFLMTEKL
EVKGKQQHQLYQWLTRKDRNGKKSSTVKWNFQKYLLDERGRLLETFESSVDPMSSKIIDF
LK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccttaaaatctttggccaagaaattggtaatgaatacatctccaatggatatc
aatataccaaaggagtctccctctgtgtatacggttaaattaaacgcccttaatggcaat
cccattcatttggaaaattttaagggaaaaaaggtgctccttgtaaatgtggcctccaaa
tgcgggtataccaaacaatatagaccactgcaaaaacttcaggatacatataaagatcaa
ctagtggtcatcgggtgtccctgtaaccaatttggctcgcaggagccgggaaacgctgag
cagattcaaaagttttgtgaactgaattatggagtggatttcttaatgacggagaagttg
gaggtcaaaggaaagcaacaacaccagctataccaatggttgactagaaaagataggaac
ggaaagaaaagttccacggttaaatggaattttcaaaaatacctgttggatgaaagaggt
aggctattggaaacatttgaatcatccgtagaccctatgagttcaaaaatcatcgatttt
ttaaagtaa

DBGET integrated database retrieval system