KEGG   Sediminicola sp. YIK13: SB49_15440Help
Entry
SB49_15440        CDS       T04145                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
syi  Sediminicola sp. YIK13
Pathway
syi00471  D-Glutamine and D-glutamate metabolism
syi00550  Peptidoglycan biosynthesis
syi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SB49_15440
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SB49_15440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syi01011]
    SB49_15440
Enzymes [BR:syi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     SB49_15440
Peptidoglycan biosynthesis and degradation proteins [BR:syi01011]
 Precursor biosynthesis
  Amino acid ligase
   SB49_15440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C PYRIN AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALM09029
UniProt: A0A0S1SFT6
Position
3490364..3491698
Genome map
AA seq 444 aa AA seqDB search
MERLVILGGGESGVGTAILGKKMGYDVFVSDGGKIKEKYKNALENLGVDWEEERHTEAKI
LIADVVMKSPGIPDTVSLVVKLREMNIPVISEIEFASRYTEATIIGITGSNGKTTTTMLV
NHLLKNGGLNVGMAGNIGDSFAKMVAEQDYDYYVLEISSFQLDGIVEFKPHIAIITNISP
DHLDRYDYKFENYIASKFKIVQNQTDEDYLIYDADDEVIMDYLEQHKISSKLIPFSLEKE
FTEGAYIKNNKIQITTQNNTMEMEQDTLALEGKHNLKNTMAASTAAKLVQIRKQTIRESV
QNFQGAAHRLEKVLKIHHVQYINDSKATNVNATYYALDSMKTPTVWIVGGLDKGNDYKSL
MPMVREKVKAIVCLGLDNSKIKDAFGNVVDLMVETFSMEEAIKVAYKIAERGDTVLLSPA
CASFDLFKNYEDRGDQFKEAVKNL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggagagattggtcattttaggcgggggagaaagtggtgttggaactgccattttgggc
aagaaaatgggctatgatgtctttgtgtccgatggagggaaaattaaggaaaaatataaa
aatgctctcgaaaatctaggagtagattgggaggaggaaagacatacagaggctaaaata
ttgattgccgatgtggttatgaagagccctggaataccagatacggtttccttggtggtt
aaacttagggaaatgaacatccccgttatttccgaaatagagttcgcttcgagatatacc
gaagctactattattggaataacagggagcaatgggaagaccacgactaccatgttggtg
aatcatttgttaaaaaatggtggattgaacgtgggaatggccggtaatattggcgacagt
tttgcgaaaatggttgcagaacaggattatgactattacgtgttggagataagtagtttt
caattggatggcattgtggaatttaagccacatatcgcgatcataaccaatatatctccc
gaccatttggatcgatatgattataagtttgaaaattatatcgcttccaaatttaagata
gtacaaaatcaaaccgatgaggattaccttatttacgatgctgatgatgaagtaataatg
gattatttggaacaacacaaaatatcatccaagttgattcccttttccctggagaaagaa
tttacggaaggcgcatatataaaaaataataaaatacagattacaactcaaaataacaca
atggagatggagcaagacactttggctttagaaggcaagcacaaccttaaaaacactatg
gcagcatcaactgcagccaagttggtgcagattagaaaacagacaatccgagaaagtgtc
caaaattttcaaggcgccgcccatagattggaaaaagtattgaagatccatcatgtgcag
tacatcaatgattccaaagctaccaatgtaaatgcaacgtattatgcattggacagtatg
aaaacccctaccgtttggattgtaggtgggttggataaagggaacgattataaatcctta
atgccaatggtcagggaaaaggtaaaggccatagtgtgtttgggattggataattcaaaa
ataaaggatgcatttggcaatgtagtggatttaatggtggagactttttcaatggaagaa
gccataaaggtggcttataaaattgctgaacgaggtgacaccgtattattgtccccggcc
tgtgccagttttgacctatttaaaaattacgaagacaggggagatcaatttaaagaagct
gtaaaaaacctatag

DBGET integrated database retrieval system