KEGG   Synechocystis sp. PCC 6714: D082_10780Help
Entry
D082_10780        CDS       T03386                                 

Gene name
chlL
Definition
(GenBank) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein ChlL
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
syj  Synechocystis sp. PCC 6714
Pathway
syj00860  Porphyrin and chlorophyll metabolism
syj01100  Metabolic pathways
syj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D082_10780 (chlL)
Enzymes [BR:syj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     D082_10780 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ MeaB AAA_25 AAA_24 AAA_26 RNA_helicase NACHT AAA_16 SRP54
Motif
Other DBs
NCBI-ProteinID: AIE73606
UniProt: A0A068MU35
Position
complement(1070133..1071053)
Genome map
AA seq 306 aa AA seqDB search
MKLPEHHPRPSIFLGATPLTLTLAVYGKGGIGKSTTSCNISTALAKRGKKVLQIGCDPKH
DSTFTLTGFLIPTIIDTLQEKDFHYEDIWPEDVIYKGYAGVDCVEAGGPPAGAGCGGYVV
GETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYADYCLIVTDNGFDALFAANRIA
ASVREKARTHSLRLAGLIGNRTSKRDLIDKYLEAVPMPVLEILPLIEDIRVSRVKGKTLF
EMAESDPSLEYVCEYYLNIADQLLAQPEGVVPKDAQDRDLFSLLSDFYLNPTQPASQTKE
LDLMMV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcctgagcatcatcccagacctagcatttttttaggagcaactcccttgaca
ctgacacttgcggtatatggaaaaggcggaatcggtaaatccaccaccagttgcaacatc
tctacagcgttagccaaacggggtaaaaaagttctccaaattggttgtgatcccaaacat
gacagcacctttaccctcaccggtttcttgattcccaccatcattgacacgttgcaagaa
aaagattttcactacgaagacatctggcccgaggatgtaatttacaaaggttatgctggg
gttgattgtgtagaggccggtggaccccccgctggagctggttgtggcggttatgtggtg
ggggaaacagtgaaattgctgaaggaactcaacgcctttgacgagtacgacgtgattctg
tttgacgtgctaggggacgtagtttgtggtggttttgccgccccgttaaactatgccgac
tattgtttgattgttacagacaacggttttgatgctctgtttgctgccaaccgaatcgct
gcttccgtgcgggaaaaagctcgtacccatagcctccgcctggctggtttaattggcaat
cgcacttccaaacgggacttaattgataaatatctggaagccgttcccatgccagtgttg
gaaattttgcccttaattgaagacattcgggtttcccgagtcaaaggcaaaaccttattt
gaaatggccgagtccgacccttccctggaatacgtttgtgaatattatttgaatattgcg
gatcaacttttggcccaaccggaaggagtagtgcccaaggatgcccaggatcgggatttg
tttagcctactctctgatttctacctcaatcctacccagcccgctagccaaaccaaagaa
ttagacttgatgatggtttag

DBGET integrated database retrieval system