KEGG   Synechococcus sp. PCC 7003: AWQ21_00585Help
Entry
AWQ21_00585       CDS       T05991                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
syl  Synechococcus sp. PCC 7003
Pathway
syl00480  Glutathione metabolism
syl00590  Arachidonic acid metabolism
syl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AWQ21_00585
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AWQ21_00585
Enzymes [BR:syl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AWQ21_00585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ANV83019
UniProt: A0A1B1TKZ9
Position
117628..118122
Genome map
AA seq 164 aa AA seqDB search
MTTQTPTSIYDFSATAIDGTSVDLSTYKDQVLLIVNTASQCGFTPQYKGLQALHEQYGGK
GLVVLGFPCNQFGQQEPGNETQIQSFCKTTFGVSFPMFQKIDVNGSNAHPLYQYLTKEAP
GILGTKNVKWNFTKFLINRQGQVVKRYAPTATPEAIAKDIQELL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgactacccaaacgcctacttctatttatgatttttcggccacagctattgatggcaca
tcggttgatctcagtacctacaaagaccaggttttattgattgttaatacagccagtcaa
tgcggatttactcctcaatacaaaggtttgcaggcactccatgaacaatatggcggcaaa
ggcttagtcgttcttggttttccctgtaaccaatttggccaacaagaacccggcaacgaa
acgcaaattcaatcattttgtaaaacaacgtttggggtttcttttccgatgtttcaaaaa
atcgatgttaatggcagcaatgcccatccgttatatcaatatttaaccaaagaagcaccc
ggtattttggggacaaaaaatgtgaaatggaattttacgaagtttctcattaatcgccag
ggtcaagtggtaaaacgttatgcacccacggcaacaccagaggcgatcgccaaagacatc
caagaattactttaa

DBGET integrated database retrieval system