KEGG   Synechocystis sp. PCC 6803: sgl0001
Entry
sgl0001           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Other DBs
NCBI-ProteinID: BAA10494
CyanoBase: sgl0001
CYORF: sgl0001
UniProt: P74773
Position
complement(2816991..2817110)
AA seq 39 aa
MELTYTGEKISLLPWIGEEVTDDARYYNVNLAQHPYKNW
NT seq 120 nt   +upstreamnt  +downstreamnt
gtggaattaacctacactggtgaaaaaataagtctacttccctggatcggggaagaggta
acggatgatgcccgctattacaacgtcaatttagcccaacatccctacaaaaattggtga

DBGET integrated database retrieval system