KEGG   Synechocystis sp. PCC 6803: sll0060
Entry
sll0060           CDS       T00004                                 
Name
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: AI-2E_transport
Other DBs
NCBI-ProteinID: BAA10289
CyanoBase: sll0060
UniProt: Q55153
Position
complement(2585489..2586523)
AA seq 344 aa
MNWPNMPPGDRRWLWIGLTLPLCLLNGWVLLQILDYFQSPLRIFIIANLVAFILGYPVRW
LQRYPRLKLPYAVALVLLTTAIILAVIGLLVIPKLVDQIRTVLQLLPHLNALGDRHLESL
DNLSNQWEIPTNFRAWGRELSNEFPNQIRSITNQLINLLIWTAGSLVEAGFIFIMTVYLL
LRGQTFWDGIFRWLPIDWRHKVRQRLRHSFQNYYIGQATVAALLGVSLIISLSIFQVPLA
LLFGMFVGFMAFFPFGGGTSIVLISIIASFQSIWLGIKVLAIATVVDQVVENGLAPKLLG
RVTGVHPVWILLSLMIGAKVAGLLGILVAIPIASFIRDMLNDFI
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaattggcccaatatgccccctggcgatcgccgttggttgtggattggtctgacgttg
cccctgtgtctgctcaacggttgggtactactgcagatattggattatttccagtccccc
ctgagaatttttattattgcgaacctggtcgcttttattctcggttatccggtgcgttgg
ctccagcgctatccccgtctaaagttgccctacgcagtggcattggtattactcaccacg
gcgattattttggcggtgattggtctgttggtaattcccaaattagtagatcaaattcgt
actgttttacaacttttgccccatctcaatgccctgggcgatcgccacttagaaagccta
gataatttaagcaatcagtgggaaattcccaccaatttccgtgcttggggccgggaatta
tccaatgagtttcctaaccaaattcgctccattaccaaccaattaataaatttattgatt
tggactgcaggtagcttagtagaagccggctttatctttattatgactgtctatttattg
ctgcggggacagacattttgggatggcatattccgttggttacccattgattggcgtcat
aaggtacgacaaagattacgccatagttttcagaattactacattggccaagccaccgtg
gcggcgttgctaggggttagtttaatcatttctctaagcatttttcaagtgcccctggcc
ctactatttggtatgtttgttggctttatggctttctttccctttgggggaggcaccagc
attgttttaatcagtattattgccagttttcagagcatttggttgggcattaaagtcttg
gcgatcgccactgtagtggatcaggtggtggaaaatggcctagccccaaaattactgggt
cgtgtcaccggggtgcaccccgtttggattttactttccttgatgattggtgccaaggtg
gccggattgttaggtattttagtggctatccccattgctagtttcatacgggatatgctc
aatgattttatctag

DBGET integrated database retrieval system