KEGG   Synechocystis sp. PCC 6803: sll0083
Entry
sll0083           CDS       T00004                                 

Gene name
gmhA
Definition
(GenBank) phosphoheptose isomerase
  KO
K03271  D-sedoheptulose 7-phosphate isomerase [EC:5.3.1.28]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00540  Lipopolysaccharide biosynthesis
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    sll0083 (gmhA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:syn01005]
    sll0083 (gmhA)
Enzymes [BR:syn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.28  D-sedoheptulose 7-phosphate isomerase
     sll0083 (gmhA)
Lipopolysaccharide biosynthesis proteins [BR:syn01005]
 Unusual sugar
  sll0083 (gmhA)
SSDB
Motif
Pfam: SIS_2 SIS
Other DBs
NCBI-ProteinID: BAA10549
CyanoBase: sll0083
CYORF: sll0083
UniProt: Q55797
Position
complement(2879965..2880549)
AA seq 194 aa
MSEWVEQRLQSLAKAFDQSYCGAIEAVVDLICQRFQAGNKLLICGNGGSAADAQHLAAEF
VGRFHFNRQALPAIALTANSSILTSVSNDYTYDIVFSRQVEALGQPGDILWGLSTSGKST
NVLHALKCAKDKGLHTIGMAGNNGGLFQEFADYPLFVADKNTPCIQEVHLMTYHHICEQV
ESRLFAQKSVGIKV
NT seq 585 nt   +upstreamnt  +downstreamnt
atgtctgaatgggttgaacagcgtttacagtcccttgccaaggctttcgatcaatcctat
tgcggagccattgaggccgtggtagatctgatttgccaaagattccaggcgggtaataaa
ttgctcatctgcggtaacgggggatccgccgccgatgcccaacacctggccgctgaattt
gtcggccgtttccatttcaaccgccaagccctaccggcgatcgccttgaccgccaacagt
tccatcctcacgtctgtcagcaacgattacacctacgatattgttttttcccgtcaagtg
gaagctttgggccaaccgggggatattctttggggtttgtccacttcgggtaaatccacc
aatgtgctccatgcgctgaaatgtgccaaggataagggtttacacaccatcggcatggct
ggtaataacggtggtttgttccaggaatttgctgactatcccctcttcgtcgccgacaaa
aacactccctgcatccaagaagtgcatttgatgacctaccatcacatctgtgaacaggtg
gaatcccgtctcttcgcccaaaagtctgtgggaatcaaagtctag

DBGET integrated database retrieval system