KEGG   Synechocystis sp. PCC 6803: sll0084Help
Entry
sll0084           CDS       T00004                                 

Gene name
hisB
Definition
(GenBank) imidazoleglycerol-phosphate dehydratase; histidinol-phosphatase
  KO
K03273  D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC:3.1.3.82 3.1.3.83]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00540  Lipopolysaccharide biosynthesis
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    sll0084 (hisB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:syn01005]
    sll0084 (hisB)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.82  D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     sll0084 (hisB)
    3.1.3.83  D-glycero-alpha-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     sll0084 (hisB)
Lipopolysaccharide biosynthesis proteins [BR:syn01005]
 Unusual sugar
  sll0084 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like HAD_2 Hydrolase PNK3P HAD
Motif
Other DBs
NCBI-ProteinID: BAA10548
CyanoBase: sll0084
CYORF: sll0084
UniProt: Q55796
Position
complement(2879286..2879771)
Genome map
AA seq 161 aa AA seqDB search
MQLPAGAGEALTQWQKAGYLLIVITNQAGIGRGYFDHGDVAAVHTKIRQEYGKEGVKFTD
FFLCPHHPEDGCDCRKPSPEMLLRAAEQYQISLQESYFIGDAPSDVGAAIAAGCQPVVLM
TGRGEETCQQLDKFRLQLAGPIPVFANLGETVSLLASLSSK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgcagttaccggccggtgccggggaagctttaacccagtggcaaaaagcaggatattta
ttaattgtgatcaccaatcaggcgggcattggccggggttattttgaccacggtgacgtg
gcggcggtccataccaaaatccgacaagagtacggcaaagagggagtaaagttcaccgat
tttttcctttgcccccaccatccagaggacggttgtgattgccgtaaaccttcccccgaa
atgttgttgcgggcggcggagcagtaccaaatttctctccaggaatcctactttattggc
gatgcccccagtgacgtgggagcagccattgcggccggttgtcagccagtggtgctaatg
acagggcggggtgaggaaacttgccaacagttggataagtttaggttgcaattagctggg
ccaattcccgtctttgccaatctgggggaaactgttagtctgctggcttccctttcaagc
aaatga

DBGET integrated database retrieval system