KEGG   Synechocystis sp. PCC 6803: sll0085
Entry
sll0085           CDS       T00004                                 
Name
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF6569
Other DBs
NCBI-ProteinID: BAA10547
CyanoBase: sll0085
UniProt: Q55795
Position
complement(2878078..2879289)
AA seq 403 aa
MNSDHSRDQPLFISLIPHLMGGKGHIVPYHGAVRRSVEYLGWQYQAWVPQDADPNLEEIG
DRLHRILLPEDLEAEGSMVAKITRLPQAMQCSDVLAQQLQSLLTNGESRPVILFLERFIH
LQLFAIWWGLRQLSPEARSRLHFWILYRRDVHLDQTRSIYHWLHQRLRKLLPPPQCQFLT
DSEPLGRSLQDYFGQPFTVMPIPHTDFAEVVPLFTEADPILCWWPGAPREEKGWSVMRHL
VSLPRPNSPRLQLIAAAASGLKSDSEGIEVHLIGDRLTREEYAGWLNKAQIILLPYDPEA
YAERTSGIFTEAIIAERIPLVSPGTWMARELNQYDLDSLVVDWQAQSLVWAEIDQKLADS
SIHQQLAAMAQAYRRHHSLESYAKTLQEIWLSRHNGNMEVNNM
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgaactctgaccattctcgggatcaacccctatttatttctctcataccccatctgatg
ggagggaaaggccatattgtgccttaccacggggcggtacggcgatcggtagagtatttg
gggtggcagtatcaagcttgggtgccccaggatgcggatccaaatttagaagaaattggc
gatcgcctccatcgaattcttctgccggaggatttggaagcggaggggagcatggtggca
aaaataacccgtcttccccaagccatgcaatgtagtgatgttttagctcaacaattgcaa
tctttgttaaccaatggggaaagtagaccagttattctatttttagaacggttcatccat
ctccaactgtttgctatctggtggggactacggcaattatctcccgaagcccgaagccga
ttgcatttttggatcctctaccgtcgggacgtgcatctagaccaaacccgttctatttac
cattggctccaccaacgcttacggaaattattacccccaccccaatgccaatttttaacc
gatagtgaacccctcgggcgatcgctccaggattattttggccaaccattcaccgtgatg
cccattccccacacggattttgctgaagttgtacctttatttacagaagctgatcccatt
ctttgctggtggcccggtgcccctcgggaagaaaaaggttggtcggtgatgcgtcatttg
gtttcattgccccggcctaattcacctaggctccaactaattgcggcggcggcttccgga
ttaaaaagtgacagtgaaggaattgaagttcatttaattggcgatcgcctgactagggaa
gaatacgccggttggttaaataaagcccaaattattctcttaccctacgatccagaagct
tatgcagaaaggacttccggcattttcaccgaagccatcatcgcagaaagaataccgtta
gtatctccgggcacctggatggccagggaattaaaccagtacgacctcgacagtttagta
gtggattggcaagcccaatccctagtatgggcagaaattgaccaaaagttggccgattca
agcatccatcagcaattagcagccatggcccaagcttaccgtcggcaccacagcctagaa
agttatgccaaaaccctgcaagaaatctggctttcccggcataatggaaacatggaagtt
aacaatatgtaa

DBGET integrated database retrieval system