KEGG   Synechocystis sp. PCC 6803: sll0086
Entry
sll0086           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K01551  arsenite/tail-anchored protein-transporting ATPase [EC:7.3.2.7 7.3.-.-]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:syn04131]
    sll0086
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    sll0086
Enzymes [BR:syn01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.7  arsenite-transporting ATPase
     sll0086
Membrane trafficking [BR:syn04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Golgi to ER traffic proteins (GET)
    sll0086
Transporters [BR:syn02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   sll0086
SSDB
Motif
Pfam: ArsA_ATPase ArsA_HSP20 AAA_31 CbiA ParA AAA_24 CBP_BcsQ Fer4_NifH UPA IstB_IS21 MeaB SRP54 AAA_25
Other DBs
NCBI-ProteinID: BAA10546
CyanoBase: sll0086
CYORF: sll0086
UniProt: Q55794
Position
complement(2876845..2878035)
AA seq 396 aa
MRVILMTGKGGVGKTSVAAATGLRCAELGHKTLVLSTDPAHSLADSFDLELGHEPRLVKE
NLWGAELDALMELEGNWGAVKRYITQVLQARGLDGVQAEELAILPGMDEIFGLVRMKRHY
DEADYDVLIIDSAPTGTALRLLSLPEVGGWYMRRFYKPLQGMSVALRPLVEPLFRPIAGF
SLPDKEVMDAPYEFYEQIEALEKVLTDNTQTSVRLVTNPEKMVLKESLRAHAYLSLYNVS
TDLVIANRILPETIDDPFFQRWKSNQQVYKQEIYDNFHPLPVKEAPLFSEEMCGLAALER
LKDTLYKDEDPSQVYYKENTINIVQGSNNDYSLELYLPGIPKEQIQLNKTGDELNVRIGN
HRRNLVLPQALAALSPAGAKMEDDYLKIRFAEAVKR
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgcgcgtaattctgatgacaggtaaagggggggttggtaaaacctccgttgcggcggcc
accggtctccgttgtgcggaattaggccataagaccctagttctgagtaccgaccctgcc
cattccctcgctgacagttttgatctggagttgggccatgagcctcgcctggtgaaggag
aatctttggggagcagaattggatgctttgatggagttggaaggcaactggggcgcagtt
aagcgttacattacccaggtattacaggcccgggggctagatggagtacaggcggaggaa
ctggccattctccctggcatggatgaaatttttggtctggtgcggatgaaacgccactat
gacgaagctgattatgatgtactgattatcgattctgctcccacaggtactgccctacgt
ctgctcagtttgccggaagtgggggggtggtatatgcgacgtttttataagcctttacag
gggatgtccgtggccctcagaccattggtggaacccctatttagaccgatcgccggtttt
tctttgcccgacaaggaagtgatggatgctccctacgaattttatgagcaaattgaagcc
ctggaaaaagtgttaacagataacacgcagacttccgtacgtttggtgaccaacccagaa
aagatggtgttgaaggaatcattgcgggcccatgcctacctaagtttgtacaatgtatcc
acggatttagtcattgctaaccggattttgcccgaaaccattgatgatcccttcttccaa
cggtggaaaagtaaccaacaggtctataaacaagaaatttatgacaatttccatcctctg
ccggtgaaggaagcgcccctattctcggaagaaatgtgtggcttagcagctttggaaaga
ctgaaggacactttgtacaaagatgaagatccttcccaggtttactacaaggaaaacacc
attaacattgttcagggcagcaacaatgattacagtttagaactttatttaccaggtatt
cccaaagagcaaattcaactaaataaaactggcgatgagttaaatgttcgtatcggtaac
catcgccgcaacttggttctgccccaggctttggcggccctaagtcccgctggagcaaaa
atggaggatgattacctcaaaattaggtttgctgaggcagttaaacggtaa

DBGET integrated database retrieval system