KEGG   Synechocystis sp. PCC 6803: sll0103
Entry
sll0103           CDS       T00004                                 
Name
(GenBank) unknown protein
  KO
K07114  Ca-activated chloride channel homolog
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    sll0103
Transporters [BR:syn02000]
 Other transporters
  Pores ion channels [TC:1]
   sll0103
SSDB
Motif
Pfam: VWA VWA_3 VWA_2 VWA_CoxE vWA-TerF-like DUF2201
Other DBs
NCBI-ProteinID: BAA10635
CyanoBase: sll0103
UniProt: Q55874
Position
complement(2975741..2977003)
AA seq 420 aa
MRIDLSLLLSDQNLDAGAPTSQRQLRIAVAAKADDHDRRLPLNLCLVLDHSGSMDGQPLE
TVKSAALGLIDRLEEDDRLSVIAFDHRAKIVIENQQVRNGAAIAKAIERLKAEGGTAIDE
GLKLGIQEAAKGKEDRVSHIFLLTDGENEHGDNDRCLKLGTVASDYKLTVHTLGFGDHWN
QDVLEAIAASAQGSLSYIENPSEALHTFRQLFQRMSNVGLTNAHLLLELAPQAHLAIVKP
VAQVSPETMDLTVQNQGAIEEVRLGDLMTDQERVLLLNLYLDQLLPGQHVIGQVQIRYDD
PASGQTNLLSDPLPLTIQVQTQYQPSTDVQVQESILTLAKYRQTQIAETKLKAGDRQGAA
TMLQTAAKTALQMGDKNGATILQTNATRLQSGEDLSEGDRKKTRMVSKTTLQPPSAPSEH
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgcgtatcgacctttccttgcttttaagtgaccaaaatttggatgctggggcccctacc
agtcagcggcagttgcggatagccgtggcggccaaagcggatgaccatgatcgccggttg
cctttgaatttgtgcttagtattggaccacagtggctctatggatggtcagcctttagaa
acggttaaaagtgcggccttggggttgatcgatcgcctggaggaagatgatcgcctttcg
gtcattgccttcgaccaccgggccaaaattgtcattgaaaatcaacaggtgcggaacggg
gcggcgatcgccaaagccattgaaaggttaaaagcggaagggggcaccgccattgatgag
gggttgaaactgggcattcaggaagcggctaaaggtaaggaagaccgggtttcccatatt
tttctgctcaccgatggggaaaatgagcatggggataatgaccgttgcctgaaacttggc
acggtggcatcggactataagctcacggttcatacccttggttttggcgaccattggaat
caggatgtgctggaggcgatcgccgcttcggcccagggcagtttgagttatatcgaaaat
cccagcgaagcgttgcatacctttcgccaactgttccaacgcatgagcaatgtcgggtta
accaacgcccatctcctgctggaattagcgccccaagcccatcttgccatcgtcaagccc
gtggcccaggtatcgccggaaaccatggatttaaccgtgcaaaaccagggagcaattgag
gaagtgcgtctaggagatttgatgaccgaccaagaaagggtcttactgctcaacctttac
ctagaccaattactgccggggcaacacgtcattggccaagtgcaaattcgttacgatgac
cctgcttctgggcaaaccaatctgctgtccgacccgttacccttgaccattcaggtgcaa
acccagtaccaacccagcaccgatgtccaagtgcaggaatccattctcaccctggctaaa
tatcgtcagacccaaatcgctgaaactaagctcaaagccggcgatcgccaaggggcggcc
accatgctgcaaaccgccgccaaaaccgccctacaaatgggcgataaaaatggcgctact
attttgcaaaccaatgccaccagacttcaatccggggaagatttatccgaaggcgatcgc
aaaaagacccgcatggtcagcaaaaccactctccaaccgccctctgcgccatcagagcat
taa

DBGET integrated database retrieval system