KEGG   Synechocystis sp. PCC 6803: sll0142
Entry
sll0142           CDS       T00004                                 
Name
(GenBank) cation or drug efflux system protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: ACR_tran
Other DBs
NCBI-ProteinID: BAA18562
CyanoBase: sll0142
UniProt: P74461
Position
complement(2197732..2200959)
AA seq 1075 aa
MSSPNSVFSLSGLAIRRHIATLMLTLAIIVLGVFAVFSLPVDLLPSITYPRIGVRLDAPG
VSPEVAVDEITRPLEAALSATEGVVQVYSQTREGQISLDLFFEPGGNIDQALNDATATFN
RARNQLPDDLETPRLFKFDPSQLPVYEFAVTSPELSGPSLRVFAEEELARELGVVPGVAS
VNVSGAAQEEVRINVDLQRLQRSGVSLTQVLDALQSRNVDISGGRIVGTESEPLTRTVGR
FASAQEIEDLVVGTVSGLEDQSAQKVYLRDVATVIDGTEEERIFVTLNGNPAVKVSVQKQ
PEANTIEVVDGVKKRLEELRTEGIIPQAAELTPTLDDSVFIRNSVNNVVVSGLIGTVLAA
IAVLLFLGSLRQTLIIVLAIPLATMAAIIVMKAFGLSLNVFSLGGLALGVGIVVDNSIVM
LETIAEGAGMTPGKVNPLPLTKGEMRNQAIASSQTVESALVASTSTNLVAVLPFLMIGGF
IALIFNELILTISFAVAASILVAVTLVPMAASRLLAIRRRSGLGNWLFFREFNRRFAGAT
AAYARFLSILIRHRLVAVASIFIVFGGSSLWMIGQIPQEILPRINTGQASMFAQFPPGTP
LEENQRLMAIVDDILINQPETEYAFTTVGGFLFGSNVNANALRSSSTITLKPNTDVEAFT
ERVTAELEALNLVDIRLRMAPGQLRGLILSNSPLRNVDVDVVLQGNDADVLDEAGRAVLA
ELGEKVTLARFRPDADPRQPEVQIRPDWQRATELGLTTQAIGQTVQTALDGAVPTQLQRE
NRLVDVRVKLDNDLLSGPGDLAQIPLFIDGDRPIRLGDVATIDQGRAPGEIQRINQRPVF
LIAGTLVEGASLSEALTEVDQVLSAMEFPPGVSRLPSTAAASNEQLQSSLVILGGLAAFL
VFVVMAVQYNSLLDPLVIMFTLPLALAGGILGLYVTQTAIGATVIVGTVLLVGIVVNNAI
IMVELANQIWAEEGISREAAILRAAPQRLRPILMTTITTVLGMFPLALGIGQGSELLQPL
GIVVFSGLSLATLLTLFLIPCLYVLLHQWEGVDIEKVKTDLESRLTEEDVPTKIQ
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgtcctcccccaactccgtttttagtctgagtggcctggccatccgtcggcacattgcc
acccttatgctcaccctggccattattgtgttgggggttttcgctgttttttccctgccg
gtggatctgttgccttccatcacctatccccgcattggcgtgcgactagatgctccaggg
gtatctccggaagtggcggtggacgaaattaccagacccttggaagcggccctgtcagcc
acggaaggggtggtgcaggtttactctcaaaccagggaggggcaaattagcctggatttg
tttttcgagccggggggcaatattgaccaagcgttgaatgacgccaccgctacctttaac
cgggcccgcaaccagttgccggatgatctggaaaccccccggttatttaagtttgatcct
tcccagttgccggtgtatgaatttgccgttacctccccggagttgtcggggccatcgttg
cgggtatttgcagaagaggagttagcacgggaattgggagtggtgccgggggtggcatcg
gtgaatgtgtcgggggcagcccaggaagaagtccggatcaatgtggatttacaacgacta
cagcggtcgggggtgagtttgacccaggtattggatgctttacagagccgaaatgtggat
atttccgggggcagaattgttggtacggagtcggaacctttaacccgtacagtgggtaga
tttgcttcagcccaggaaattgaggatttagtggtgggcacagtgtctggtctggaggat
caatcggcccaaaaagtttatctgcgggatgtggccactgttattgacggtacagaggaa
gaacggatttttgtgaccctcaacggtaatccggcggtaaaagtgagtgtgcagaaacaa
ccggaggctaacaccattgaagtagtggatggggttaaaaaacgtttggaggagttacgc
acagaaggcattattccccaggcggcggaattaacccctaccttagatgattcagttttt
atccgtaactcggtcaataacgttgttgtttcggggttaattggtacggtcctggcggcg
atcgccgttttgttatttctcggttctttgcgacagacgttaattattgtgttggctatt
cccttggccaccatggcggccatcattgtcatgaaggcctttggtttatccttgaacgtt
tttagtttggggggcttggccctgggggtgggcattgtggtggataactccatcgtcatg
ttggaaaccattgcggaaggggcgggcatgacccccggcaaagttaatcccctcccacta
actaaaggggaaatgcgcaaccaggcgatcgccagtagtcaaacggtggaatcggcactg
gtggcttccactagcactaacttggtggcggtattgccatttttgatgattggtggcttc
attgccctgatttttaatgaattaattttgaccatcagttttgcggtggcggcttccatc
ctggtggcagtgaccctagtgcccatggccgcttcccgtttattggccattcgccgccgg
agtggtttgggtaattggttattttttcgggaatttaaccgacgttttgcaggggccacg
gcggcctacgcccgttttttatccatcctgatccgacatcgattggtggcggtggcttct
attttcattgtttttggtggcagtagtttgtggatgatcggacagattccccaggaaatt
ttgccccgcatcaatacgggtcaagccagtatgtttgcccagttcccccccggcactccc
ttagaggaaaaccaacgcttaatggcgatcgtggatgacatcctcatcaatcagccggaa
accgaatacgctttcaccacggtgggggggtttctctttggcagtaacgttaatgctaat
gctctgcgcagttccagcaccattaccctaaaacccaataccgatgtggaggcattcacc
gaacgggtgacggcggaattggaagcgctgaacttggtggatattcgtctgcggatggca
ccgggacagttgcggggtctgattttaagcaattcccccctacgtaacgtagatgtggat
gtggttttgcaggggaatgatgccgatgtgttagatgaagcggggcgggcagtgttggcg
gaattaggagaaaaagttacattggcccgttttcgtcccgatgccgatccccgtcaaccg
gaagtgcagattcgtcccgattggcaaagggcgacggaattaggtttaaccacccaagcc
attgggcagacagtccaaactgctttagacggtgctgtgcccacccagttgcaacgggaa
aatcgcctggtggatgtgcgagtgaaattggacaatgatttgctctctggccctggggat
ttggcacaaattcccctctttattgatggcgatcgcccgatccgtttgggggatgtggcc
accattgaccaaggtcgggcaccgggggaaattcaacgcattaaccaacggccggtgttt
ttaattgctggtacgttagtggaaggggctagtttgagtgaagctctcacagaagttgac
caagttttatccgccatggagtttccccccggggtgtctcgactgcccagtacagcggcg
gcgagcaatgaacagttacagtcttccctggtgattttagggggcttggcggcgtttctc
gtctttgtggttatggcggtgcaatacaattctctcctcgatcctctggtaattatgttc
accctacctttggctttggctggaggcattttgggtttatacgttacccaaacggcgatc
ggtgccacggtaattgttggtacagtactcctggtggggattgtggtcaacaacgccatc
atcatggtggagttagctaaccaaatctgggccgaagaaggcatcagtcgagaagcagct
atcttacgggcagccccccaacgcttacgaccgattttgatgaccaccattaccaccgtg
ctgggcatgtttcccctcgccctgggcattggacaaggatcagaattgctccaacctttg
ggcattgtggtgttttccggtctttccctcgctaccttactaaccctatttttaattccc
tgcttgtacgtgttgctacaccaatgggaaggggttgatatagaaaaagtcaaaaccgat
ttggaatcccgcttaaccgaagaagatgtaccaacaaaaatccaataa

DBGET integrated database retrieval system