KEGG   Synechocystis sp. PCC 6803: sll0168
Entry
sll0168           CDS       T00004                                 
Name
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Other DBs
NCBI-ProteinID: BAA10061
CyanoBase: sll0168
UniProt: Q55560
Position
complement(2317112..2317447)
AA seq 111 aa
MLMKCWLAAADLLVIAAEDLPAYKKGGSIVRNNYFWALQAIACHSGRGRDWEFDEVVWVA
LGRLLLFFLNSGYLMTSETLLEFPCDEVIPLSLRSVATWQAPGDDGGLESF
NT seq 336 nt   +upstreamnt  +downstreamnt
gtgttgatgaaatgttggttagcggcggcggatttgctggtgattgccgctgaagatttg
ccagcttacaaaaaaggtggttccattgttcggaataattatttttgggccctccaggcg
atcgcctgtcacagcgggcggggtcgagattgggagttcgacgaagtggtgtgggtagcc
ctggggagactattgctgttttttcttaattctggttatctgatgacatccgaaaccctg
ctggaatttccctgtgatgaagttattccccttagcctgcggtcggtggccacctggcaa
gctcccggggacgatggaggactagaatcgttttga

DBGET integrated database retrieval system