KEGG   Synechocystis sp. PCC 6803: sll0207
Entry
sll0207           CDS       T00004                                 
Symbol
rfbA
Name
(GenBank) glucose-1-phosphate thymidylyltransferase
  KO
K00973  glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00521  Streptomycin biosynthesis
syn00523  Polyketide sugar unit biosynthesis
syn00525  Acarbose and validamycin biosynthesis
syn00541  O-Antigen nucleotide sugar biosynthesis
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01250  Biosynthesis of nucleotide sugars
Module
syn_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    sll0207 (rfbA)
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    sll0207 (rfbA)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    sll0207 (rfbA)
   00525 Acarbose and validamycin biosynthesis
    sll0207 (rfbA)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     sll0207 (rfbA)
SSDB
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Fucokinase
Other DBs
NCBI-ProteinID: BAA10218
CyanoBase: sll0207
UniProt: Q55689
Position
complement(2512467..2513648)
AA seq 393 aa
MVSVDRFLLTDNCSLNPRPNNITAIKIFMKALILSGGKGTRLRPLTYTGAKQLVPVANKP
ILWYGIEAIAKAGITDIGIIISPETGEEIKTITGNGEKFGIQITYILQSEPLGLAHAVKT
AADFLQDSPFVMYLGDNLIQDHLEQFLAHFQAKSLDSLILLRRVSNPSAFGVATVNDQGK
VLALVEKPEHPPSNLALVGLYFFAPTIHQAIANIEPSARGELEITDAIQYLISHDYRVES
LQLKGWWLDTGKKDDLLAANQIILDTLVEKNIQGTVDDQSKISGRVTIGPHSQIINSVIR
GPVAIGPNCHLENCFIGPYSSIAEGVKIRDADLEHSVVLQGASIVAIQQRIVDSVIGKNA
KIFPAPRRPQALRFLIGNDSQVELIGPSSYPQD
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggtcagtgttgaccgattcctgcttactgataactgttcactgaaccctagacccaac
aacataaccgctatcaagatttttatgaaggctctcattctctccggtggcaaaggaact
cgcttgcgtcccctcacctacaccggggctaagcagttggtgcctgtggctaacaaacca
atcctctggtatggcattgaggcgatcgccaaagctggcattaccgacattggcattatt
attagcccagaaacgggagaggaaattaaaactatcaccggcaacggagaaaagttcggt
atccagattacctatattttgcaatccgaaccattggggttggcccatgcagtgaaaacg
gcggcagactttctccaagattccccttttgtgatgtatttaggcgataacctaattcaa
gaccacctagagcaattcctcgcccattttcaggctaaatccctcgattccttgattcta
ctgcggcgagtgtccaatcccagcgcctttggggtggccaccgttaatgaccaaggcaaa
gttttagccctagtggaaaaaccagagcatcccccttccaacttggccctagtgggactt
tacttttttgccccgaccattcaccaggcgatcgccaacattgagccctctgcccgggga
gaactagaaatcaccgatgcaattcaatatctgatcagccatgattatcgggtggaatcc
ctacaactaaaaggatggtggctcgacaccggtaagaaagacgacctgctggccgccaat
cagattatcctcgataccctagtggaaaaaaacatccaaggcaccgtagacgatcaaagc
aaaatctccggtcgggtaaccattggcccccacagtcaaattatcaacagcgtcatccgt
ggccccgtggcgatcggccccaactgtcatctggaaaactgcttcatcggtccctatagc
agtattgccgagggagttaaaatcagggatgcagatcttgaacatagtgtcgtgctccaa
ggagctagcattgtggccatccaacaaagaattgtcgatagtgtcatcggcaaaaacgcc
aaaatttttcccgctccccgccgtccccaggctttgcgcttcctgattggtaatgattcc
caagtggaactaattggaccctcttcctatccccaggactaa

DBGET integrated database retrieval system