KEGG   Synechocystis sp. PCC 6803: sll0221
Entry
sll0221           CDS       T00004                                 
Symbol
bcp
Name
(GenBank) bacterioferritin comigratory protein
  KO
K03564  thioredoxin-dependent peroxiredoxin [EC:1.11.1.24]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    sll0221 (bcp)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     sll0221 (bcp)
SSDB
Motif
Pfam: AhpC-TSA Redoxin AhpC-TSA_2
Other DBs
NCBI-ProteinID: BAA16726
CyanoBase: sll0221
UniProt: P72719
Position
complement(161088..161642)
AA seq 184 aa
MTSKKFSWPKTIIALLLTLGLWLGLADLPTYALGGIQPELDQPAPLFTLPSTTGEGEVNL
TDYRGQWVVLYFYPQDFTPGCTLEAQRFQRDLTKYQALNAQVIGVSVDDLDSHEAFCDAE
GLKFPLLADSDGAVIKTYGSWLSGMALRHTYVIDPEGILRERFLGVRPATHSEEVLARLA
ELQA
NT seq 555 nt   +upstreamnt  +downstreamnt
atgacaagcaaaaaattctcctggccaaaaactatcattgccctacttttaaccctaggt
ttatggctaggattggcagacttacccacctatgccctggggggtatccaaccagagttg
gatcaacctgcgcccctgttcaccctgcccagcaccaccggagaaggggaagttaatttg
acagattaccggggtcaatgggtggttttatatttctatccccaggactttacccccggt
tgtaccttggaggcccagcgtttccagcgggatttgaccaaatatcaagctctcaatgcc
caggtaattggggtaagtgtggacgacttagactcccatgaagctttttgtgatgcggaa
gggcttaagtttcccctgctggcggactccgacggggcagtaatcaagacctatggctct
tggctcagtggcatggccctacgacacacctacgtcatcgatcccgagggtattttgcgg
gaaagatttctgggagtgagacccgccacccacagtgaagaagttttggcccggttggca
gaattacaagcctaa

DBGET integrated database retrieval system