KEGG   Synechocystis sp. PCC 6803: sll0244
Entry
sll0244           CDS       T00004                                 
Symbol
galE
Name
(GenBank) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00052  Galactose metabolism
syn00520  Amino sugar and nucleotide sugar metabolism
syn00541  O-Antigen nucleotide sugar biosynthesis
syn01100  Metabolic pathways
syn01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    sll0244 (galE)
   00520 Amino sugar and nucleotide sugar metabolism
    sll0244 (galE)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    sll0244 (galE)
Enzymes [BR:syn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     sll0244 (galE)
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NmrA NAD_binding_10 NAD_binding_4 adh_short DUF1800
Other DBs
NCBI-ProteinID: BAA17951
UniProt: P73887
Position
complement(1521210..1522226)
AA seq 338 aa
MATQQTILVTGGAGYIGSHGVLALQQAGFDVLIYDNLSYGHKELVQPLGVELVVGHTGDR
QKLDQLFATRNIAAVMHFAAFIAVGESVQKPDIYYQNNVVGTLTLLEAMLAAGIKKFVFS
STCAVYGMPKEIPMTESHPIDPLSPYAASKRMVEQILADFDQAYGFKSVIFRYFNASGAD
PQGRLGEDHNPETHLIPLALLTALKQRPQLSVFGTDYDTLDGTALRDYIHVCDLAIAHVL
GLQYLLEGGESNIFNLGNGNGFSVRQVIEVAKAVTGLDIPYQLCPRRPGDAPILVGSSAK
AREILGWNPQYPDLHTIIDHAWQWHQRRHGDYKKSNKI
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggccacgcaacaaacaattttggtcaccggaggggcgggttacatcggctcccatggg
gtgcttgccctacaacaggcgggctttgacgtccttatctacgataacctcagctacggt
cacaaggaactagtgcaacccctgggggtggaattggtagtcggccatactggcgatcgc
caaaaactagaccaactttttgccactaggaatattgctgctgtcatgcattttgccgcc
ttcatcgccgtgggagaatcggtgcaaaagccggacatttattaccaaaacaacgtagtg
ggtactctcaccctcctggaagccatgctagcggcgggcattaagaaatttgtcttttcc
tccacctgtgcggtctatggcatgccgaaggaaattcccatgacggaaagccatcccatt
gatcccctcagtccctatgccgccagcaaacgcatggtggaacaaattttggctgacttt
gaccaagcttacggcttcaaatcagttatttttcgctactttaatgcttccggcgcagac
ccccaaggacgcttaggagaagaccataaccccgaaacccatctaattcccctggccctg
ttgacagctttgaaacaacgtccccaactttccgtttttggtactgattatgacaccctc
gacggcaccgccttacgggattacatccatgtctgtgacctggcgatcgcccatgtatta
ggcttgcaatacctgctagaaggaggggaaagcaatatctttaacctcggtaatggcaac
ggcttttccgtgcgtcaagtaattgaagttgccaaagcggtgacgggattagatattccc
tatcagctatgtccccgccgtcccggtgatgcccccatcctggtcggtagtagtgctaaa
gcgcgggaaatccttggctggaatccccagtaccctgacttacataccatcattgaccat
gcctggcagtggcaccaaaggcgccatggagattacaaaaaaagcaataaaatttga

DBGET integrated database retrieval system