KEGG   Synechocystis sp. PCC 6803: sll0249
Entry
sll0249           CDS       T00004                                 
Name
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Esterase Ser_hydrolase
Other DBs
NCBI-ProteinID: BAA17946
CyanoBase: sll0249
UniProt: P73883
Position
complement(1515669..1516424)
AA seq 251 aa
MTNQNMPPETPIIWLNFSPALRRFDRPLLRQLGKSQAILQWDYHQTADEPNCLTVGLDLI
GEYLENFHQPVHLIGHSTSGLLALLYARQCPEKVRSLSLLSVGVYPALDWQAHYYSQFDA
MRYSRHLLLGQMAHHLFNCRSLRQTQTIVNILENDLLTSISPHSLYKQLIILPNHIAVPL
LVAVGETDGIIDTSLFNGWQRWKKPGDRLWLCPEGKYFFQFEHPEITAFQLQQFWRSLQG
QEASSSTSLLA
NT seq 756 nt   +upstreamnt  +downstreamnt
atgacaaaccagaatatgcccccggaaacacctatcatttggcttaattttagtcctgct
ctgcggcgttttgatcgtcctctactacgacaattaggcaaaagtcaggctattttgcaa
tgggattatcatcaaactgctgacgaacccaattgtctaacagtgggattagatttaatc
ggagaatacctggaaaattttcaccaacctgtccatttaattggtcatagcaccagtgga
ttgttagctttattgtacgcccgacaatgtcccgaaaaagtccgttccctctccctactc
tccgttggtgtatatcctgccctcgactggcaagcccattattacagccaatttgatgcc
atgcgttacagccgtcatttgctccttggtcaaatggcccaccatctatttaattgtcgt
tccctacgtcaaacccaaaccattgttaatattttggaaaatgatctattaacttccatt
tctccccatagtttgtataagcaattaattattttgcccaaccacattgctgtgcccctc
ttggtggcggtgggagaaacagatggcatcattgacaccagtttatttaatggttggcaa
cgctggaaaaagcctggcgatcgcctttggttatgtcctgaaggaaaatacttttttcag
tttgagcatccagagataaccgcatttcaactacaacaattttggcgatcgctccaaggg
caggaagcctcttcttccacttctttgctggcttag

DBGET integrated database retrieval system