KEGG   Synechocystis sp. PCC 6803: sll0369
Entry
sll0369           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF3953
Other DBs
NCBI-ProteinID: BAA10404
CyanoBase: sll0369
CYORF: sll0369
UniProt: Q55757
Position
complement(2716735..2717163)
AA seq 142 aa
MQNFFVIGFQSCLRLFGAFWIFGGFLTLQAARESLFLDRAIEAIALKKQDKLLSYFLFLG
SIFTLATGITLVLASRWVFLPLTLSIVSQIVYFSVQKRRFSRAKTEEEREDAQVQPTTIN
AFKTSCVVAIACALGWAVGAIK
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcagaatttttttgtcattggttttcaatcctgtctgcggctttttggtgcgttttgg
atttttggcggctttctgaccctacaggcggcgcgggaatccctctttttagaccgggcc
atagaggcgatcgccttaaaaaaacaggataaattactgagctattttttatttttgggt
agcattttcactttagccaccgggataactttggtcttagctagtcgctgggtctttttg
cccctaaccctgtccattgtttcccaaattgtttatttctccgtgcaaaaacgtcgattt
agtcgggccaaaactgaggaagaaagggaagatgcccaggtacaacccactaccatcaat
gcttttaagacttcttgcgtggtggcgatcgcctgtgccctaggctgggcggtgggggcg
attaaatag

DBGET integrated database retrieval system