KEGG   Synechocystis sp. PCC 6803: sll0467
Entry
sll0467           CDS       T00004                                 

Gene name
queA
Definition
(GenBank) queuosine biosynthesis protein; QueA
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:syn03016]
    sll0467 (queA)
Enzymes [BR:syn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     sll0467 (queA)
Transfer RNA biogenesis [BR:syn03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    sll0467 (queA)
SSDB
Motif
Pfam: Queuosine_synth
Other DBs
NCBI-ProteinID: BAA10606
CyanoBase: sll0467
CYORF: sll0467
UniProt: Q55850
Position
complement(2940566..2941666)
AA seq 366 aa
MDQDKYLSSYDYHLPADCIAQTPAVPRDHSRLLVVKDPFTVDHQHFYDLGNYLKPGDLLV
LNDTKVMPARLHGQKENGVAVEILLLTECTENQWIALVKPGKRLKLGAKVKFPARDGEKP
DLWATILQRDDATGGRLLEFVLEPGQRLWDVLPDYGEIPFPPYIGDRQATNDQYQTIYAE
KLGAVAAPTAGLHFTEELFTKLAQQGVQTAKVTLHVGIGTFRPVEAENILDHVMHQEWID
VPPTTVEVIEKTRASGGRIFAVGTTVVRCLEGMAQESDFPRQPLQPFRGQTDLFIYPGYQ
WRLVDGLITNFHLPKSSLLMLVSALISRPRLMAIYETAIAKGYRFYSFGDAMVILPEACR
GQEKIR
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggaccaggacaaatatcttagtagttacgattaccatctccctgcagattgtattgcc
caaacccccgccgttccccgggatcattcccgtctactggtggtgaaagacccattcacc
gtggaccaccaacatttttatgatttgggtaactatctgaaaccgggggatttattagtc
ctcaatgacacgaaggtaatgcccgcccgtctccatggccaaaaagaaaatggcgtggca
gtggagattttactcttgacagagtgtactgaaaaccaatggattgccctagtcaagcca
ggcaaaagattaaagctgggggccaaagttaaatttcccgccagggatggggaaaagccc
gacctctgggccaccattttgcaacgggacgatgccacggggggacggttattagaattt
gttttggagccgggacaaagactctgggatgtgttgccagactatggtgaaattcccttt
cctccctacatcggtgatcgccaagccacgaatgaccaatatcaaaccatctatgcggaa
aaattaggagcggtggcggcccccacagcggggttacatttcaccgaggaattgttcaca
aaactagcccaacagggagtacagacagcgaaagttactctccatgtgggcattggcacc
tttcgccccgtggaagcggaaaatattctcgaccacgtaatgcaccaagaatggattgat
gtacctccaacgacggtggaagtgattgaaaaaactagggccagtgggggcagaattttt
gcggtgggcaccacggtggtgcgctgtttggaaggcatggcccaggaaagtgattttccc
cggcaacccctgcaaccctttcggggccagacggatttgtttatttaccccggttatcaa
tggcgcttagtggatgggctgattaccaattttcacttgcccaaatccagtttattaatg
ttggtcagtgccctaatcagccgcccccggttaatggccatttacgaaacggcgatcgcc
aaagggtaccgattttactcctttggagatgccatggtgattctgccggaagcttgccga
ggacaggaaaaaattcgataa

DBGET integrated database retrieval system