KEGG   Synechocystis sp. PCC 6803: sll0477
Entry
sll0477           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: MotA_ExbB
Other DBs
NCBI-ProteinID: BAA10590
CyanoBase: sll0477
CYORF: sll0477
UniProt: Q55834
Position
complement(2923803..2924567)
AA seq 254 aa
MLDNCKRLLFRKFPCFLSMAPSPLFLTQTPRLLDEFLKGGVVMFPLLLLSILALTTAFER
GWFWSRLLIQEDQVVRDVLDAAVEDLVKAREIAEHARHLAIGRFLLAPLKLRHPSPETFR
LAMEATADKEFARMRRGDKLLETIIALAPLLGLLGTVTGLIRTFNNLNIGGGGSSAEATQ
AASGIGEALITTAAGMMVAIFALLVFRVLVSLQSQQMDYFAAVGSELELIYREVWYEPHQ
PMPNLLMAARIAEP
NT seq 765 nt   +upstreamnt  +downstreamnt
gtgctggataattgcaagagattattatttagaaaatttccctgttttctgtccatggcc
ccatcccccctgtttttgactcaaactccgcggctactcgatgagtttcttaagggaggg
gtagtgatgtttcctttgttactgctgtccatccttgcccttaccactgccttcgaacga
ggttggttttggagtcgcctactgattcaagaagaccaggttgtgcgggatgtgctcgat
gcggcggttgaggatttggtaaaggctcgggaaattgctgaacatgctcgacatttagcc
attggtcgttttctgctggctccccttaaactacgccatcctagtccagaaactttccgt
ttggccatggaagccaccgccgataaagaatttgcccgaatgcgacggggggataaactc
ctggaaactatcattgccctagctcctctcttgggcttgttaggcaccgtaacgggctta
attcgcacttttaacaatctcaatatcgggggaggaggctccagtgcggaggctacccag
gccgcctcgggcattggagaagcgttgattaccacggcagcggggatgatggtggcgatt
tttgccctgttagtatttagggttttggtcagtttacagtcccaacaaatggattatttt
gccgcagtgggcagtgaattagaacttatttaccgtgaggtctggtacgaacctcatcag
ccaatgcccaatttattaatggcggctagaattgctgagccataa

DBGET integrated database retrieval system