KEGG   Synechocystis sp. PCC 6803: sll0478Help
Entry
sll0478           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ExbD
Motif
Other DBs
NCBI-ProteinID: BAA10589
CyanoBase: sll0478
CYORF: sll0478
UniProt: Q55833
Position
complement(2923356..2923799)
Genome map
AA seq 147 aa AA seqDB search
MKSRVRGARTPGINLVPMIDVLMSVLTFFVILTMSLTGRVIADLEPPESAGGFAKEEDSS
PQTKVKAPSLDVGLNRQGDVLLGGNIVERDKLLTAIATFLATHPQGEVRLTVDGQLNYRQ
VDDLLVQMVEVGGDRVLLVVHKSDPEL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccgagtcaggggggcaaggactccagggattaatttagtaccgatgattgat
gtcttgatgtcggtattaaccttttttgtaattttaaccatgtctttgactggtagggtg
atcgccgatctagagccaccggagagcgcaggcggttttgccaaagaagaggattcatcc
ccccaaacaaaggtcaaggcacctagtttagatgtgggtttaaatcgtcagggtgacgtt
ttgctgggaggcaatatcgtcgaaagggataaattattaacggcgatcgccaccttttta
gcgacccatccccagggtgaggtgaggttaacggtggacggacagttaaactatcgtcaa
gtggatgatttattagtccaaatggtggaagtaggcggcgatcgggtccttttggtggtt
cataaatcagacccagagctatga

DBGET integrated database retrieval system