KEGG   Synechocystis sp. PCC 6803: sll0485
Entry
sll0485           CDS       T00004                                 

Definition
(GenBank) NarL subfamily
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Response_reg KaiA
Other DBs
NCBI-ProteinID: BAA10575
CyanoBase: sll0485
CYORF: sll0485
UniProt: Q55820
Position
complement(2909975..2910874)
AA seq 299 aa
MTQEPYQILLIEDDSATAAMVDHCFGPSIVSPLVERLPVQITTVSNLAEAVDICQDREFA
VVLLDLFLSELQGIDTLIKARTIFPDQSIIVYSQSEDEHLVIQAFQHGADGYLRLKNLDS
YLLYYELLSVLERNIYRRKSENQRNLASQQKEYSALETLISSTTSVTARMFGSDTIKDSF
PELFGELKQTYGELLELALDQRAFRVDHNLSERLRNLADRLGFMKASPRDIIEIHTTVLK
EKNHNINVIKSQAYATEGRLIVLELMGYLASFYRKYYVSLNNLNISSRISPRFPPKDSS
NT seq 900 nt   +upstreamnt  +downstreamnt
atgacccaggagccctaccaaattctactgattgaagatgattcagcaacggcagccatg
gttgaccattgcttcggaccgtcgattgtatcccctttggtggaacgtctaccggtacaa
attacgacggtgtcaaatttggctgaggcggtggacatttgccaagatcgagagtttgcc
gtggttttattagatctatttctatcggaactccaaggcattgataccctaattaaagcc
cgcacaattttccccgaccaatccatcattgtctatagccaaagtgaagatgagcattta
gttattcaagcgttccagcatggggccgatggctatttacgactgaaaaatctcgacagt
tatttgctttattatgaattactatcggttttagaaagaaatatttatcgtcgcaagagt
gaaaatcaacgaaacttagccagccaacagaaggaatacagcgccctggaaaccttaatt
agctccaccaccagcgtcactgcccggatgtttggttctgataccatcaaagattccttt
ccagaattatttggggagttgaaacaaacctatggagagttgttagaattagcattggat
caacgcgcttttagggtagaccataatctttctgagcgcttgagaaatttagccgatcgc
ctaggttttatgaaagccagccccagggatattatcgaaatccacaccaccgtcctaaag
gaaaagaatcacaatattaatgtaattaaatcccaagcctacgccaccgagggcagattg
atagtattagaattaatgggctatttagcaagcttctatcgcaaatactatgtcagcttg
aataacttaaatatttcctcgcgtatttcaccacgatttccccccaaagatagttcttaa

DBGET integrated database retrieval system