KEGG   Synechocystis sp. PCC 6803: sll0539
Entry
sll0539           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF4105
Other DBs
NCBI-ProteinID: BAA10505
CyanoBase: sll0539
CYORF: sll0539
UniProt: Q55411
Position
complement(2826754..2827947)
AA seq 397 aa
MMELNFFLRNQNLCVYSPSTIFSKGKLAKSTVIKLLVSALAVVFMGSEATGAEPECKAIN
REVLMSHGMTFNEDDSCRQTDDPYEFPSRVFIRPDPDRVRRWQNEDGRLFWSTATPPGAN
PADAGQCVNVEHFRPVIGITPGELNFLGLKPTENQVVIANVRDLDGFAIAVFSRDSIADM
IFQVVEADVPVLGRLGIHSQVRMRLKPGHQVLLHHQWPYEAVPYKIVDELFFSIHGVGSG
QEIGRINYNPKLLLSVLDGSRLLVFAIHTREFRLWDTYARLKNANINQYPLQLNHNEINR
YIDKFLRISSESRLNKHYLLTERNCTNGQFRLLEYAKGHQFQPDCLWPPWTNGTIHPDKS
AEALRTRGLIAPDEVNAIGHYEEEPAVLELLQSWGFL
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgatggaactcaattttttccttcgaaatcagaacttatgtgtttatagtccaagtaca
attttctcgaagggtaagttagccaaatcgacggtaattaaacttctagttagtgcgctt
gctgttgtgttcatggggtcggaagctactggtgcagaaccagaatgtaaggcgatcaat
cgggaggttttaatgtcccatggaatgactttcaacgaggatgacagttgccgccagacc
gatgacccttatgaatttccttcgcgagtgtttattcgtccagatccggaccgtgttcgc
cgttggcagaatgaagatggtaggcttttttggtcaacggccactcctcccggagcaaat
ccggccgacgctggacagtgtgtgaatgttgagcacttcaggcccgttataggaataacg
ccaggggagctgaattttttgggattaaaaccaactgaaaatcaggttgttattgccaat
gtgcgggacttagatggttttgccattgcggtcttttctcgcgattcaattgcagacatg
atttttcaagttgttgaggcggatgtaccagtattaggtcgtttaggcattcactcccag
gttcgcatgaggcttaaacccggtcaccaggttttactccatcaccaatggccatatgaa
gcagtgccttacaagattgttgatgagttgtttttttctattcacggcgtgggctctggc
caggaaataggacgaattaattacaacccgaaacttcttttaagtgtgcttgacggctcc
cgtttacttgttttcgcgatccacacaagggaatttcgcctatgggacacgtatgcgcgg
ttgaaaaatgcaaatattaatcagtatcctcttcagttgaaccataacgaaatcaataga
tatatagacaaatttcttcgtatttcgtcagagagtcgcctaaataagcactatttgctc
acggagcggaattgcacgaatgggcagtttaggttgcttgagtatgccaagggccatcag
tttcagccagattgtttgtggcccccttggacaaatggaactatccatccagacaagtcg
gcggaagccctgcggacaaggggattaattgcgcctgatgaggtgaatgctattggtcat
tacgaggaggagccggctgttcttgagctacttcaatcttggggttttctttaa

DBGET integrated database retrieval system