KEGG   Synechocystis sp. PCC 6803: sll0541
Entry
sll0541           CDS       T00004                                 

Gene name
desC(des9)
Definition
(GenBank) acyl-CoA desaturase 1
  KO
K23054  sn-1 stearoyl-lipid 9-desaturase [EC:1.14.19.28]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    sll0541 (desC(des9))
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.28  sn-1 stearoyl-lipid 9-desaturase
     sll0541 (desC(des9))
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-ProteinID: BAA10500
CyanoBase: sll0541
CYORF: sll0541
UniProt: Q55406
Position
complement(2822579..2823535)
AA seq 318 aa
MLNPLNIEYLYLSKLFDNSLIVFNKRQLFRFFVRFFFMTAALPNDSKPKLTPAWTVIFFF
TSIHLVALLAFLPQFFSWKAVGMAFLLYVITGGIGITLGFHRCISHRSFNVPKWLEYIFV
ICGTLACQGGVFEWVGLHRMHHKFSDTTPDPHDSNKGFWWSHIGWMMFEIPAKADIPRYT
KDIQDDKFYQFCQNNLILIQVALGLILFALGGWPFVIWGIFVRLVFVFHFTWFVNSATHK
FGYVSHESNDYSRNCWWVALLTFGEGWHNNHHAYQYSARHGLQWWEVDLTWMTIKFLSLL
GLAKDIKLPPETAMANKA
NT seq 957 nt   +upstreamnt  +downstreamnt
atgttaaacccattaaacattgaatacctatatttaagcaaactttttgacaatagttta
atcgtttttaacaagcgccaattattccgttttttcgttaggttttttttcatgactgct
gctcttcccaacgattccaagcccaagttgactccagcttggactgtgatcttctttttt
acctccattcatttggtggccctgttggctttcctgccccagtttttcagttggaaagca
gtggggatggctttcttgctctatgtaattaccggcggcattggcattactttaggtttt
caccgttgtatttcccaccgcagtttcaatgttcctaaatggttagagtatattttcgta
atctgtggcaccctagcctgtcaggggggcgtatttgagtgggtcggcttacaccgtatg
caccacaaattttctgacaccaccccggatccccacgattctaataagggtttttggtgg
agtcacatcggctggatgatgtttgaaattcctgctaaagctgatattccccgctacacc
aaggatatccaagacgataaattttatcaattttgccagaataatctaattcttatccag
gtcgccctaggcttgattttatttgccttagggggctggcccttcgttatttggggcatt
tttgtccgcctagtgtttgttttccacttcacttggtttgtcaacagtgccacccataag
ttcggctacgttagccatgaatccaatgattattcccgcaattgttggtgggtagcattg
ttaactttcggtgaaggttggcacaataatcaccacgcctatcagtactctgctcgccat
ggtttgcaatggtgggaagtggatttaacttggatgaccattaaattcctatctttgctg
gggttagccaaggatattaaacttcctccggaaactgcgatggccaacaaagcctag

DBGET integrated database retrieval system