KEGG   Synechocystis sp. PCC 6803: sll0584
Entry
sll0584           CDS       T00004                                 

Gene name
ycf36
Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF1230
Other DBs
NCBI-ProteinID: BAA10625
CyanoBase: sll0584
CYORF: sll0584
UniProt: Q55866
Position
complement(2962706..2963227)
AA seq 173 aa
MKPMRESSPQICPVPIDQQPVNEYEALKSAWLYSWGQVDLLSYGKNLTRLALLISFIVSP
IASASFSVEKQPVQCGFLIVLGICLLLSLFVLRLMLGWRYVGDRLGAETVTYEESGWYDG
QVWRKPLEVQTRDQLILRYQVNPVLQRWQNTLKLLGATMAIDILIWTIFRFLH
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaagccgatgcgggaatcttccccccaaatctgtcctgtgcctatcgaccaacagccg
gtcaacgaatatgaagcgctcaaatccgcttggctctattcctggggtcaagtagatctg
cttagctacggcaaaaacctcacccgtctggccctgctgatcagttttattgtcagtccg
atcgcctctgccagtttttcggtggaaaagcaaccggttcaatgcggttttctgattgtg
ctgggtatttgccttttattgtctctgtttgtgttgcgcttgatgttgggctggcgttac
gttggcgatcgcctaggggcggaaaccgtcacctacgaagaatccggttggtacgatggc
caggtgtggcgcaaaccattggaagtgcaaaccagggaccaacttattttgcgctatcaa
gttaaccccgtactacaacgttggcaaaatactctgaaactcctgggggccaccatggcg
atcgacattcttatttggaccatttttcgatttctccattga

DBGET integrated database retrieval system