KEGG   Synechocystis sp. PCC 6803: sll0585
Entry
sll0585           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00250  Alanine, aspartate and glutamate metabolism
syn00460  Cyanoamino acid metabolism
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    sll0585
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    sll0585
Enzymes [BR:syn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     sll0585
SSDB
Motif
Pfam: Asparaginase_II DUF637
Other DBs
NCBI-ProteinID: BAA10624
CyanoBase: sll0585
CYORF: sll0585
UniProt: Q55865
Position
complement(2961619..2962647)
AA seq 342 aa
MPRIEDRLINRTPRNFTIIGNSPNSMSRGKRPHTTPIEVHLLREGIIESQHWAEATVYDD
RGRVLMLAGDSTSNAFIRSSLKPFQALAVTSTGTMERYGLTDKDLAIMCGSHQGTIEQAR
QVFNILWRADIEPQALQCPIPAGQESPLYHGCSGKHAGMLAVCQQQDWPLHSYLQQNSPI
QKLILSKVADLLGMPGAELIAAHDDCGAPTYTMELGQIAHLYALLASGQQLGLERVARAM
TYYPYFVAGEGCFDTELMQQMEGELVSKSGAEGVQCVGRVGEGLGLAIKVKDGSKRAKYA
VAIHLLQQMGWIPPQVAETLSEKFVRLGKYKRLEVIGELAML
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgcctagaattgaggataggttaatcaatagaaccccgcgaaactttaccatcatcgga
aattcccccaacagcatgagcagaggaaaacgtccccacactacccccatcgaagtgcat
ttgctgagggaaggcatcatcgaatcccagcactgggctgaagccacagtctacgacgac
aggggaagggttttaatgctggccggcgatagcaccagcaatgcctttattcgctcttcc
ctcaaaccgtttcaagccctagccgtcaccagcaccggtaccatggaacgctatggtctt
accgacaaagacctggccattatgtgtggttcccaccaaggcaccattgaacaagctcgg
caggtattcaacattctttggcgggccgacattgagcctcaagctctgcaatgtcccata
ccagcgggacaggaaagccctctataccatggttgctccggtaaacatgcggggatgctg
gccgtttgccaacaacaggactggccgctccacagttatttgcaacaaaatagtcccatc
caaaaactaattctgtccaaagtagcggatctgttgggcatgcccggagccgaattgatc
gctgcccatgacgactgcggtgcccccacctacaccatggagttgggacaaatagctcat
ttgtatgcgctgctggcttcggggcaacagttgggtctggaacgagtggctcgggccatg
acttactacccctattttgtcgctggggaaggctgttttgatacggaacttatgcaacag
atggaaggagagctggtgagtaaatccggcgctgaaggggtgcaatgtgtggggcgagtg
ggagaaggcttaggcttagccatcaaagtaaaagacggttccaaacgggctaagtatgct
gtagccattcacctgctgcaacaaatgggctggattcctccccaggtggcggaaactctg
tcggaaaaattcgtccggctgggtaaatataaacgcctggaagtgattggcgaattagcc
atgctgtga

DBGET integrated database retrieval system