KEGG   Synechocystis sp. PCC 6803: sll0586
Entry
sll0586           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: HI0933_like DAO Pyr_redox_2 FAD_binding_2 GIDA FAD_oxidored NAD_binding_9 Amino_oxidase Lycopene_cycl Thi4
Other DBs
NCBI-ProteinID: BAA10622
CyanoBase: sll0586
CYORF: sll0586
UniProt: Q55864
Position
complement(2959530..2960756)
AA seq 408 aa
MTRTVIVVGGGAAGFFGAINCARNLPEGRVILLEAGSKFLAKVRISGGGRCNVTHHCFDP
TQLVQNYPRGGKALRGAFSRFQPQQTIAWFGAEGVQLKTEADGRMFPVTDDSGTIVDCLL
SAARRSGVELRNRSPVQGLEKLGEQFQVTLKSGEIINGDRLLLATGSNPLGYRWAAQLGH
TIQAPVPSLFTFNIPNAQLTDLAGVSVENALVSLDPKFKGIYCHQGPVLITHWGLSGPAV
LKLSAWGARQLQASGYDHSLWINWLPKVTPLESMAQWRATKQSHPRKQIANFTATALPKR
LWQRLTTQAGIKPGQCWADFSKVQERQLTENIHRYHCQIKGKGVFKEEFVTCGGITLKEV
DFKTMASRCCPGLYFAGEILDVDGITGGFNFQNAWTTAWLAAQGMAAP
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgacaagaactgtgattgtggtcgggggaggagcagctggcttttttggggcgattaac
tgtgccagaaatctgccggagggtagagtaattttgttggaggcggggtcgaaattcctg
gctaaagtccgcatttctggggggggacgttgtaatgtgacccaccattgctttgacccg
acccagttagtgcaaaactatccccgggggggtaaggcgttgcggggagcgttcagtcgt
tttcaaccccagcaaacgatcgcctggtttggggcggagggggtgcaactcaaaacggaa
gcagatgggcggatgtttcccgttaccgatgactcaggcaccattgtggattgtttgctg
tcggcggcccggcgatcaggagtggagttaagaaatcgatcgccagtgcaagggctggaa
aaactgggggagcaattccaagtaacgcttaaatcgggggaaatcattaatggcgatcgc
ctgttattggccacgggcagtaatcccttgggctatcgctgggcagcacaattgggtcat
accatccaagctccggtgccttccctgtttacctttaacattccaaacgcccagttgacc
gatctggccggggtgagtgtggaaaacgccctagtgagtttagacccaaaatttaaagga
atctattgtcaccagggcccggtgttgattacccattgggggctgagcggcccagcggtg
ttaaagctatctgcctggggagcaagacaattacaggcatcgggttatgaccattccctc
tggatcaactggctgcctaaagtgactcccctggaatccatggcccaatggcgagcaaca
aagcaaagccatccccgcaaacaaatcgctaactttaccgccactgctttacctaaacga
ctttggcagaggttgacgacccaggctggtattaaaccggggcaatgttgggccgatttt
tccaaggttcaggagcgacaactaacagagaatatccaccgctaccactgtcagatcaaa
ggtaaaggggtgttcaaagaagaatttgtcacctgtgggggcattaccctcaaggaagtg
gattttaagaccatggctagccgttgttgccctggattatattttgccggggaaatcctc
gacgtagatggtattaccggcggttttaattttcaaaatgcctggactacggcttggttg
gcggcccaggggatggcggctccataa

DBGET integrated database retrieval system