KEGG   Synechocystis sp. PCC 6803: sll0594
Entry
sll0594           CDS       T00004                                 

Definition
(GenBank) transcriptional regulatory protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: HTH_Crp_2 Crp cNMP_binding HTH_31
Other DBs
NCBI-ProteinID: BAA10610
CyanoBase: sll0594
CYORF: sll0594
UniProt: Q55854
Position
complement(2944272..2944889)
AA seq 205 aa
MFVNSSPIADGLSALVGLDSQPLQFYERGDVVPPKDQGCWQIYRGILQVSQWTLGGDEVL
MGWAQPGSFVGLDFSAHQRETYQIRALTDVYLRGYSLEMITNNANLCRLVLDQTLQQVRQ
REALLAIAGYKRVDERLQGLLNLLGQELGQPGTGGMRLSVRLTHQMLANAIGTTRVTVTR
LLGEFQTQGKVSLDGDRHLVIALGN
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtttgtgaacagttccccgatcgccgatggtttaagtgccttagtaggcttagactcc
cagcccctccaattctatgaaaggggtgacgttgttccgcccaaagaccaggggtgttgg
caaatttaccgggggattttacaggtcagtcaatggaccttgggaggcgatgaggtgctg
atgggttgggcccaacccggtagttttgtgggcttagattttagtgcccatcaacgggaa
acctaccaaattcgagctttgacggatgtatatctgcggggttattccctggaaatgatt
accaacaacgctaatttatgtcgcttggtgcttgaccagaccctacagcaggtgaggcag
agggaagctctactggcgatcgccggttataaacgggtggacgaaagactccaaggccta
ctgaacttactaggacaggaattggggcaaccagggaccgggggcatgcgtttatcggtg
cggctcacccatcaaatgttagccaatgccattggcaccaccagggtaacagtcacccgt
ctgctgggggaattccaaacccagggaaaggtcagtttagacggcgatcgccatttggtc
attgccttgggaaactag

DBGET integrated database retrieval system