KEGG   Synechocystis sp. PCC 6803: sll0597Help
Entry
sll0597           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport DUF2981
Motif
Other DBs
NCBI-ProteinID: BAA10607
CyanoBase: sll0597
CYORF: sll0597
UniProt: Q55851
Position
complement(2941756..2942883)
Genome map
AA seq 375 aa AA seqDB search
MNIAPVVDSLSAPAMLEELKQSPPWLRLSLLFPLFFLNGWLIYKAMGFLQPLSSLLVAAA
LLAFLLDIPVRILVEKGLKRPWAVASVLLIALVVISLFLLIVIPLAIDQLGQLLDNLPGW
FRSGNAQLLMLQAWVNEHYANLQVDLQPLISQAIEKLSRILNSFGNQLLGLVGVTISTSI
NGLILLVLTIFLVLGGEKIWDGIFSWFPHPWQRDLQNLIRDTFEGYFATQAILAGILSVA
QMVVFTLLQAPYAILFAITIGLSTLIPFASALSIIVISLLLMLENFWLGVKILLAAVIVG
QINDNVISPRLMGNRTGLNPAWIIVSLFVGSKLGGVLGLLVAVPLASVIKATSDRLRGLP
KKSGEQPAEVSVVST
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgaacattgcccccgtagttgatagtctgtctgcgcccgccatgttggaagaactgaaa
caatcccccccttggctccggctgagtctgctctttcctctctttttcctcaacggttgg
ttaatctacaaagccatgggttttttgcaacccctcagtagtttgttggtggcggccgcc
ctactagcttttttattagatattcccgtccgaattttggtggaaaaaggtctcaaacga
ccctgggcggtggctagcgttctactcattgccctggtcgtcatcagtctttttctgtta
atcgtcattcccctggcgatcgaccaattgggacaactgctggataacttacccggctgg
ttccgttccggcaacgcccaactgctgatgctacaagcttgggtcaatgagcattacgcc
aatctccaggtggacctccaacccctgatcagtcaggcaattgaaaagttaagccgcatt
ctcaattcctttggcaatcaactgttggggctagtgggggtcaccattagcaccagtatt
aatggcttgatcctgttagtgctgaccattttcctggtgctggggggagaaaaaatttgg
gatggcatttttagctggtttccccatccttggcagagagatttgcaaaatttaattcgg
gatacctttgaaggatattttgccacccaggcaattttagcgggtattctctcggtggct
caaatggttgtgtttaccctactccaagccccctatgccatcctttttgccattaccatc
ggtctaagcactttgattccttttgccagtgctttaagcattattgtcattagtctgttg
ctaatgttggaaaacttttggttgggggtaaaaattcttttggcggcggtgattgtgggg
caaattaatgataatgtcatctcccctcgtttgatgggtaaccgcaccggtttaaatcct
gcttggattattgtttctttgtttgtaggcagtaaattagggggagttttgggtctgttg
gtggcggtgcccctagccagcgttatcaaagcaacgagcgatcgcctgcggggattaccg
aaaaaatctggggaacagcccgctgaagtttcagtggtttcgacctaa

DBGET integrated database retrieval system