KEGG   Synechocystis sp. PCC 6803: sll0825
Entry
sll0825           CDS       T00004                                 

Gene name
pcnB
Definition
(GenBank) polyA polymerase
  KO
K00974  tRNA nucleotidyltransferase (CCA-adding enzyme) [EC:2.7.7.72 3.1.3.- 3.1.4.-]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:syn03016]
    sll0825 (pcnB)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.72  CCA tRNA nucleotidyltransferase
     sll0825 (pcnB)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     sll0825 (pcnB)
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     sll0825 (pcnB)
Transfer RNA biogenesis [BR:syn03016]
 Eukaryotic type
  3'processing and CCA adding factors
   CCA adding factors
    sll0825 (pcnB)
 Prokaryotic type
    sll0825 (pcnB)
SSDB
Motif
Pfam: PolyA_pol tRNA_NucTran2_2 PolyA_pol_RNAbd
Other DBs
NCBI-ProteinID: BAA10528
CyanoBase: sll0825
CYORF: sll0825
UniProt: Q55428
Position
complement(2856160..2857410)
AA seq 416 aa
MLCPVSHLADLRQQVPFDLALLPPQACLVGGAVRDALLGRRREYLDWDFVVPSGAIETAS
AIASRYRAGFVVLDKARHIARVVFAHGTVDFAQQEGMSLEQDLARRDFTVNAIAYNFQQN
KLIDPMAGVGDLQRGQLKMVAAVNLADDPLRLLRAYRQAAQLQFTLDPDTRTVLRELAPR
IKTVAAERVQAEFNYLLGSPRGSQWLLAAWQDGILAHWFSHANLSSLNAIGCIDLAIAAI
KNQLTLVERQQFFQALGKKGIAIAKLASLVCADVKIAEGELQRLKYSRHELRSVQAILQG
YPQLSCLENSPTVRQLYFFFVELGKYLPHFVLYALAHCPHNYHSFIFELLTHYLNSGDRL
AHPQPLITGKDLIDKLHIKPSPLIGQLLTEINIAHIEGKISNEQEALAYAQELGKS
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgctttgtcctgtgagccacctggctgatttacgtcaacaggttccctttgatctggct
ctacttcctccccaagcctgtttggtcggtggtgcagtgcgggatgcccttttggggaga
cgacgggaatatttggattgggattttgtcgtgcctagtggagccattgaaacggcttcg
gcgatcgccagtcgataccgggcgggatttgtggtgttggataaggctcgacacattgcc
agggtggtatttgcccatggcacagtggattttgcccaacaggagggcatgagcttggaa
caggatctggcccggcgggatttcaccgttaacgccatcgcctataacttccagcaaaac
aaattaattgaccccatggcgggggtgggggatttgcaacggggtcaactgaaaatggtg
gcggccgtaaacctggctgatgatcctttgcggctactacgggcttaccgtcaggcggcc
cagctacaattcaccctcgatcctgacacaagaacagttttacgggaattagctccccgc
attaaaacggtggccgcagaacgggtgcaagcggaatttaactatttgctgggcagcccc
cggggtagtcagtggcttttggccgcttggcaagatggtatattagctcactggttctcc
catgctaacctcagttccctcaatgccattggttgcatcgatttggcgatcgccgccatc
aaaaaccagttaaccctggtggaacgtcaacaattttttcaagcattggggaaaaagggc
attgccattgctaagttggccagcctagtctgtgccgacgtgaaaatcgccgaaggggaa
ttacaacggttgaaatattcccgccacgaactgcgctctgtgcaggcaattttgcagggc
tatccccagttaagttgtttagaaaatagccccacggtgcgacaactgtactttttcttt
gtcgagttgggtaaatatctaccccattttgtcctctatgccctggcccactgtccccat
aattaccacagttttatctttgaactgttgactcattatctgaattcgggcgatcgccta
gcccatccccaacccttaattaccggcaaggatttaatcgacaagttgcacattaaacct
agtcctttgatcggccaactgctaacggaaatcaacattgcccacatcgaaggaaaaatt
agtaatgagcaggaagctttagcctatgctcaagaactgggaaaatcttga

DBGET integrated database retrieval system