KEGG   Synechocystis sp. PCC 6803: sll0828Help
Entry
sll0828           CDS       T00004                                 

Gene name
nylA
Definition
(GenBank) 6-aminohexanoate-cyclic-dimer hydrolase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00330  Arginine and proline metabolism
syn00360  Phenylalanine metabolism
syn00380  Tryptophan metabolism
syn00627  Aminobenzoate degradation
syn00643  Styrene degradation
syn01100  Metabolic pathways
syn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    sll0828 (nylA)
   00360 Phenylalanine metabolism
    sll0828 (nylA)
   00380 Tryptophan metabolism
    sll0828 (nylA)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    sll0828 (nylA)
   00643 Styrene degradation
    sll0828 (nylA)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     sll0828 (nylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAA10524
CyanoBase: sll0828
CYORF: sll0828
UniProt: Q55424
Position
complement(2850331..2851851)
Genome map
AA seq 506 aa AA seqDB search
MRRQADRESVLPDYVKVLKPLPFNFSNFSNRQLFANFKMTDFCLLSALDLAQLVRTRQVS
PLEITQYYLDRLGKYDQTVGSFAHVAWESAIADAKQKTKYLAGMGNSEPLPPFFGVPIAV
KDLNCVADMPVSYGVSALKENLATYDDGVVAKMKAAGFTIVGKTVTSQLGSFPYTEPPGF
LPARNPWHLDYNAGGSSGGSAAAVAAGLVPIAQGSDGGGSVRTPAACCSLVGFKPSRGRV
SQAPVGDYQSGIACHGPLSRTVLEAAALLDVMEGYITGDPYWLPSPDRPFVETTGETPGQ
LRLAYAFSLPPFSSSSEIQGAVAKVIAVCENLGHQLEEACFDVTSLIEPFAQIWKAGVGA
SGIPLPLLESVNQWLGETSGTAGDYLRGVRNMQVISRQIVGFMEQYDALILPVFNHRPPK
IGEWTHLSPPDVVQKIIEWIAPCPPANAAGLPAIAIPVGFDDQGLPLSVQIIGKPAADAL
VLALAHQMEQQLQGNQPRQLPLQFMP
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcggagacaggctgatagggagtcagtgctgccggattacgttaaggttttaaagcct
ttgccttttaatttttctaatttttctaaccgccaattatttgccaattttaaaatgact
gatttttgtttactaagcgccctcgacttagcccaattagtccgcactcgccaggtttct
cctttggaaatcacccagtattatctcgatcgcctggggaaatatgatcaaacagtaggc
agttttgcccacgtggcctgggagtcggcgatcgccgatgcgaagcagaaaaccaaatat
ttagcgggaatgggtaattctgaacctttgccaccattttttggcgtacccattgcggtg
aaggatttaaactgcgttgctgacatgccggtgagctacggggtgtcagccctgaaggaa
aatttagccacctacgatgacggtgttgtggccaaaatgaaagcggcgggattcaccatc
gtgggtaaaaccgtcacttcccaactggggtcatttccctacaccgaacccccaggattt
ttaccggcccgcaatccttggcatttggactataacgcggggggatctagcggtggcagt
gcggcggcggtggcggcgggtttggtgcccattgcccagggctccgacggtggcggctct
gtgagaactccagcagcttgttgcagcttagtgggctttaaacccagtcgtggccgggta
tcccaggctccagtgggagattaccagagtggcattgcctgccatggtcccctcagtcgc
actgtgttggaggcggcggctctgttggacgtcatggaaggttacatcacaggggatccc
tattggctaccgtcccccgatcgcccttttgtggagaccacgggggaaacccctgggcaa
ctgcgcctggcctatgctttttccctacctccctttagcagttcttctgagattcaaggg
gctgtggccaaggtgatcgccgtttgcgaaaatctagggcatcaattggaggaagcctgt
tttgatgtcactagtttaattgaaccctttgcccaaatttggaaagctggggtgggggct
tccggcattcctttacccctgttggaatcggttaatcagtggttaggggaaaccagtggc
actgcgggggactatctgcggggggtaaggaatatgcaggtgatttcccgccaaattgtc
ggctttatggaacagtatgacgccctaattttgcccgtttttaatcatcggcccccaaaa
atcggggaatggacccatctatcgccccccgacgtggtgcagaaaattattgaatggatt
gccccctgcccccccgccaatgcggccggcctaccggcgatcgccattccggtgggattt
gatgaccagggtttacccctcagtgtgcaaattattggtaagcccgccgccgatgcttta
gtcctagcgttggcacatcaaatggagcaacagttgcaagggaaccagccccgccaacta
ccgctccaatttatgccctaa

DBGET integrated database retrieval system