KEGG   Synechocystis sp. PCC 6803: sll0829Help
Entry
sll0829           CDS       T00004                                 

Gene name
rapQ
Definition
(GenBank) methyltransferase
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_31 Ubie_methyltran Methyltransf_12 TPMT MTS CMAS TehB PCMT FtsJ Methyltransf_15 Methyltransf_29 MetW Methyltr_RsmB-F PrmA Methyltransf_18 NodS
Motif
Other DBs
NCBI-ProteinID: BAA10522
CyanoBase: sll0829
CYORF: sll0829
UniProt: Q55423
Position
complement(2848345..2848983)
Genome map
AA seq 212 aa AA seqDB search
MATIFRTWSYQYPWVYALVSRLATLNVGGEERFHQLPLENLAISPGQKVLDLCCGGGQAT
VYLAQSGATVVGLDASPKALGRAKINVPQATYVQGLAEDLPFGEGEFDLVHTSVALHEMT
PAQLQSIISGVHRVLKPGGIFALVDLHRPSNWLFWPPLAIFMGLFETETAWQLINTDLGS
LLDQAGFTVVRKHLYAGGSLQVIQARANKTVN
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcaactattttccgcacttggagttatcagtatccgtgggtttacgccctagtttcc
cgcctagcgactttgaatgtggggggagaagagcgtttccatcaattgccattggagaat
ttagcaatttcaccgggacagaaggtgctggatttgtgttgcgggggtggccaagccact
gtttacctagctcaatctggagccacggtggtggggctggatgcttcccccaaggccctg
ggcagggcgaaaattaatgtaccccaggcgacctatgttcagggtttggccgaggattta
ccctttggggaaggggaattcgacctagtgcacaccagcgtcgccctgcacgaaatgact
ccggcacaactacagagcattatcagcggcgtacaccgtgtgctcaaaccaggaggaatt
tttgccttagtggatttacatcgccccagtaattggctattttggccgcccttggcaatt
tttatgggcctgtttgaaacggaaaccgcctggcagttaattaacaccgatttagggtca
ttactggaccaagctggtttcacagttgttcgtaagcatctctatgcggggggcagttta
caggtaatccaggccagagcaaataagactgttaactaa

DBGET integrated database retrieval system