KEGG   Synechocystis sp. PCC 6803: sll0830Help
Entry
sll0830           CDS       T00004                                 

Gene name
fus
Definition
(GenBank) elongation factor EF-G
  KO
K02355  elongation factor G
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:syn03012]
    sll0830 (fus)
   03029 Mitochondrial biogenesis [BR:syn03029]
    sll0830 (fus)
Translation factors [BR:syn03012]
 Eukaryotic Type
  Elongation factors
   sll0830 (fus)
 Prokaryotic Type
   sll0830 (fus)
Mitochondrial biogenesis [BR:syn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    sll0830 (fus)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    sll0830 (fus)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EFG_IV GTP_EFTU EFG_II EFG_C AAA_23 GTP_EFTU_D2 SMC_N ABC_tran MMR_HSR1 cobW AAA_29 Septin AAA_16 AAA_28 RF3_C AAA_21
Motif
Other DBs
NCBI-ProteinID: BAA10520
CyanoBase: sll0830
CYORF: sll0830
UniProt: Q55421
Position
complement(2845180..2847189)
Genome map
AA seq 669 aa AA seqDB search
MNNPTNESLRNVAIVGPYGSGKTTLLESVLWVSGSVSRKGNIKDGNTVSDSSPEAKARQM
SVEVSVAGIDYENLRLNFLDCPGSIEFAQETYGALVGAGTAVIVCEADVSRVLTLAPLFK
FLDDWAIPHLVFINKMDRAKQPFGEVLQALKSVSSRPLIPQQYPIYKGEELQGYIDLITE
QAYQYHTGSAADPIALPAELAGAEHQARQEMLEALADFDDRLLEELLEEVEPPQAEIEAD
FKQELGADLIVPVVLGAAEQDFGVRPLLDVLIKEAPDPSVTAARRSLSTDGSGPVIAQVL
KTYFTPQGRLSLARIWQGTLREADSLNGQRLGGIYRLFGNQQTPVQTATVGEIVGLARLE
NINTGTTLSTADVKPLPFVEPLPPVYGLAIAPEQRKDEVKLSTALGKLVEEDPSLTWEQN
TETQEVILWGQGEIHLKVALERLERQYKLPMVSQQPQVPYKETIRKGTEVHGRYKHQTGG
HGAFGDVYLTIKPLERGNGFSFSETIVGGVVPKQYIPGVEMGVREYLAKGPLGYPVVDIA
VTLTDGSYHNVDSSEQAFKQAARLAMTEGMPQCNPVLLEPILSVNVTTPTEFTSRVLQLV
SGHRGQILGYEARSDWKSWDQVAAHLPQAEMQNFIIELRSLTLGVGNFTWQSDHLQEVPD
KFAPNLRPD
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccccaccaatgaatccctccgcaacgtggccattgttggcccctatggcagt
ggtaaaaccaccctgcttgaaagtgttttgtgggttagtggcagtgtcagccgtaagggg
aatatcaaagacggcaacacagtgagcgatagcagccctgaggccaaggcccgccaaatg
agtgtggaagtgagtgtggcagggattgattatgaaaatttgcgcttaaatttcctcgat
tgtccaggttccatcgagtttgcccaggaaacctatggagcgttggtcggcgccggtact
gcggtcatcgtttgtgaggcggatgtgagtcgggttttgaccctcgcccctttgtttaaa
tttttggatgattgggccattccccatctggtgtttatcaataaaatggaccgggctaaa
caaccctttggggaagttttacaggccctgaaaagtgtttcttcccggcccctaattccc
cagcagtatcccatttacaaaggggaggagttacagggctatattgacctcattacggag
caagcctatcaataccacactggcagtgccgccgatcccattgcgttgccagcggaatta
gccggggctgaacaccaggcccgccaggaaatgttggaggcgttggcggactttgacgat
cgcctgttggaggaattgttggaggaagtggaaccgccccaggcggaaatcgaagcggat
ttcaaacaggaattgggggcagatttaattgtgccggtggtgctgggggcggcggagcag
gatttcggtgtccgaccattgctggatgtgttgattaaggaagcaccggaccccagtgtg
acggcggcccgccggagtttgagcaccgatggttccggccccgtcattgcccaggtatta
aaaacctatttcactccccagggtcgattatccctggctcgcatttggcagggaacttta
cgggaagctgactccctaaatggtcaaaggctggggggcatttatcgtctttttggtaat
cagcaaacaccggtacaaaccgccacggtgggggaaattgtgggtctagctcggttagaa
aatatcaacaccgggactaccctttctactgctgatgtcaaacccctgccctttgttgag
cctttgcccccggtctatggtctggcgatcgccccggaacagaggaaagatgaagtcaaa
ctcagcactgccctgggaaaattagtggaggaggacccttccctaacttgggagcaaaat
accgaaacccaagaagtaatcctttggggccaaggggagattcatctcaaagtggcactg
gaaagattggaaaggcaatataaactgcccatggtcagccaacaaccccaagttccctat
aaagaaaccattcgtaaaggcacagaagttcacggccgctacaaacatcaaaccggtggc
catggcgcatttggcgatgtgtaccttaccattaaacccctggaacggggtaacggcttt
agcttcagtgaaaccattgtggggggagtggtgcccaaacaatatattcctggggtggaa
atgggggtacgagaatatttagctaaaggcccccttggctaccctgtggtggatatcgcc
gttactttaactgacggttcctaccataatgttgacagttctgaacaggcttttaaacag
gccgcccgcctagccatgacggaaggaatgccccaatgtaatccggtgttgttggagcca
attttgagcgttaacgtcaccaccccaacggaatttacctctcgggtgttgcaactagta
agcggccatcggggccaaattcttggttacgaagcccgttccgactggaaaagttgggac
caggtggctgcccatttaccccaagcagaaatgcagaacttcattattgaactgcgttct
ttgaccttgggggtggggaattttacttggcaatctgaccatctccaggaagtgccggat
aagtttgcgcctaatttacgtccagattga

DBGET integrated database retrieval system