KEGG   Synechocystis sp. PCC 6803: sll0909
Entry
sll0909           CDS       T00004                                 
Name
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DnaJ RNase_Y_N DUF1771 Spo0A_C Baculo_PEP_C ABC_tran_CTD
Other DBs
NCBI-ProteinID: BAA18416
CyanoBase: sll0909
UniProt: P74322
Position
complement(2020349..2021035)
AA seq 228 aa
MDDLTIYTSPEEEELTAKKAELETLESELAENELKLTTFQAELHSFEQQYLGLIGSRYTE
LERIEAQITEYMDYLESSRNFKPSDGLKKLYREVAKRVHPDLATDEVERAKRQNLMAAAN
QAYEEGDEQRLREILASWESDPHSVQGEGVAAELIRVIRQIAQCRSRLVAIHRDMAELRQ
TELFELMEQVEQARQSGQDLLTEMAKHLDEQIAEAQERLQDLKEQLGV
NT seq 687 nt   +upstreamnt  +downstreamnt
atggacgacctcaccatctacacaagtccggaagaagaagagttaactgcaaaaaaggct
gaacttgaaactttagagtcagaattagcggaaaatgagcttaaattgacgacttttcaa
gctgagttacatagttttgaacagcagtatttaggactgatcggaagtcgctatacggaa
ctggaacgcattgaagcgcagattacggagtacatggactatttggagtcatcccgtaat
tttaaaccgtcggatggtttgaaaaagctatatcgagaggtggcaaagcgtgttcatcca
gatttagcaacggatgaggtggaaagggctaaacgacaaaatttaatggccgcggcaaat
caggcctacgaagaaggcgatgagcaacggttacgggaaattttagctagttgggaatct
gatcctcattcagtccaaggagaaggcgttgcagcggagttaattcgggttattcgtcag
attgcccagtgtcgttctcggttagtagccatccatcgagatatggcagagttaagacaa
acggagctttttgagttaatggagcaagtagagcaagcacgacagtctggtcaagatctt
ttgacagaaatggctaaacatctggatgagcaaattgctgaggctcaagagcgtttacag
gatttaaaagaacaattaggggtttaa

DBGET integrated database retrieval system