KEGG   Synechocystis sp. PCC 6803: sll0910
Entry
sll0910           CDS       T00004                                 
Name
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_12 TPR_8 TPR_9 TPR_16 TPR_17 TPR_7 TPR_6 ANAPC3 NatA_aux_su TPR_19 TPR_3 Paf67 SRP_TPR_like
Other DBs
NCBI-ProteinID: BAA18415
CyanoBase: sll0910
UniProt: P74321
Position
complement(2019253..2020344)
AA seq 363 aa
MTDNYKQNLARYSSDVVKKGLQLTQKITLSKSEKKFEDCTKILTKSSNHEHLFKLGVEQY
ILGNISDAIDSFTKALEFNDRFCEAYFLRGFAHSFLGNNIDSKNDLYLGLKHKQFYQDSV
IAFYSKIIIISELQASSFILSCYNDLLQIKTDINKCYNPIELSIQGAINRLLGNTQDALE
KINEALKLNSNFVSSYILRAEIHNLLGDFDAAIEDCFTSLRLNPMHINKDNTLYILGSSF
LSLEKYQSAIDYLDQSLALNGNLFNGFYNRGLAYYKMGQIKKAIKDFSDALIVKPTFVWA
YINRGVAYYDLGCHQKSLDDYNQALVIDSKCKAAYVNRSIVFRELGNHEKALEDLQKAQT
IID
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgactgataactacaaacaaaatttagctcgttattcttctgatgtggtcaaaaagggg
ttacagcttacccaaaaaatcactttatcaaagagtgaaaagaaattcgaagattgtaca
aaaatattgacaaaatcaagcaaccatgagcatctgttcaaacttggagtagagcaatat
atattaggaaatatatctgatgccatagattcttttactaaagctttagaatttaatgat
agattttgtgaagcctattttttgaggggctttgctcattcttttctaggtaataatata
gacagcaaaaatgatttatatctggggctaaaacataagcaattttatcaagattcagtt
attgctttttattctaaaattattataatctctgagctacaagcaagtagttttattctt
tcatgttacaatgatttgctacaaattaagaccgatatcaacaagtgttataatcccatt
gaattatctattcaaggggctattaacagactactgggtaatactcaagatgctcttgaa
aaaatcaacgaagccttaaaactaaattcaaattttgtatcttcttacatattacgggct
gaaatacataatcttttgggtgattttgatgcagctattgaagattgttttacttctcta
aggttgaatccaatgcacattaataaggataatacactatatatccttggttcttctttc
ctttccttagaaaaataccagtctgcaattgattacctcgatcaatcattggctttaaat
ggtaatttatttaatggattttataatagaggtcttgcttattataagatgggacagatt
aagaaggctatcaaagatttttctgatgctttaattgttaagccaacatttgtttgggct
tatattaatagaggcgtagcttactacgatttaggttgtcatcaaaaatccttagatgat
tataatcaagcgttagtcattgattctaagtgcaaagcggcatatgttaatcgaagtata
gtatttagagaacttggaaatcatgagaaggcactagaagatttacaaaaagctcaaaca
ataattgattaa

DBGET integrated database retrieval system