KEGG   Synechocystis sp. PCC 6803: sll0911
Entry
sll0911           CDS       T00004                                 
Name
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Pim RBD-FIP Rh5
Other DBs
NCBI-ProteinID: BAA18414
CyanoBase: sll0911
UniProt: P74320
Position
complement(2018851..2019237)
AA seq 128 aa
MNIQEIQTIANQLTLTLDSPQSVKLQVKQINLAQKQLRAIKKEINAHIRQINQDASQAYS
DSIVSVGLDIFGKNKWAGRVRAETRRMIERNKKDARQPYMELKDYIDQLILKGDKLKLSA
EQYLLSRE
NT seq 387 nt   +upstreamnt  +downstreamnt
atgaatattcaagaaattcaaactattgccaaccaactgaccttaacgcttgattctccc
caatccgtaaagttacaagtcaagcaaattaatcttgcccaaaagcaactacgagctatt
aaaaaggaaatcaacgcccacattcggcaaattaatcaagacgcaagccaagcctattct
gatagtatcgtttccgttggtttagatatatttggtaaaaataagtgggcagggcgagtt
cgtgcagaaactaggcgcatgattgaacgtaataaaaaagatgctcgtcagccttatatg
gaattaaaagattatattgatcagttgattttaaaaggagataagctcaaattaagtgct
gaacaatacctacttagtagagaataa

DBGET integrated database retrieval system