KEGG   Synechocystis sp. PCC 6803: sll0912
Entry
sll0912           CDS       T00004                                 
Name
(GenBank) ABC transporter
  KO
K15738  ABC transport system ATP-binding/permease protein
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    sll0912
Transporters [BR:syn02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Other ABC transporters
    sll0912
SSDB
Motif
Pfam: ABC_tran AAA_21 ABC_tran_CTD ABC_tran_Xtn AAA_29 SMC_N MMR_HSR1 AAA_16 MeaB RsgA_GTPase NACHT ATP-synt_ab NB-ARC Dynamin_N DUF5906 RNA_helicase FeoB_N AAA_23 CCD48 AAA_15
Other DBs
NCBI-ProteinID: BAA18411
CyanoBase: sll0912
UniProt: P74317
Position
complement(2014908..2016818)
AA seq 636 aa
MALITVQSLRKDFGIKEILRDATFNIEPGDRVGLIGVNGSGKSTLLKMIAGLEPFDGGEY
WCNSSAKVVYLPQQPEMDGDRTVLEQVFVDSGEQWQLVKQYELLSDKLAHQGSDEQLLNQ
LSALSAQMETSGAWELETQAKIILTQLGVDHLDAKVGDLSGGYRKRVAIAAALLSQPDVL
LMDEPTNHLDAFSVEWLQSYLQRFRGALLLITHDRYFLDRVTNRILEIDQGELYSYNGNY
GYYLTKKAEAEESEQSSQKKHRGVLRRELEWLKRGPKARSTKQKARIDRIQDMQETSFKT
GTGKVDISTAGRRIGKKVVELENISKGFENKQLIKDFSYIFTPGDRVGIVGKNGVGKSTL
MNMITGRLEPDQGTVDIGSTIHFGYFDQHSDDLSLNPNQRVIDYLKSVAELIKTTDGEVI
TAGQMLERFLFPPNQQFAPIAKLSGGEKRRLFLLRVLMRAPNVLILDEPTNDLDVQTLAV
LEDYLEDFNGCVIVVSHDRYFLDRTVETIFAFEEEGELRQYPGNYTLYLEYKKAEQVRAN
QEETELKKSQPVASVTTKVSQDSSSKKLSYKEKREYEQLEQQIPQLEEEKAQLEAQLYQS
SNGNFTELQNLTERLANLSESIDQKTERWLTLAERI
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggctctcatcactgttcaatccctccgcaaagattttggtattaaagaaattctgcgg
gacgctacgttcaacatcgagccaggcgatcgggtgggattaattggggttaatggctcc
ggtaaatccaccctgttgaaaatgattgccgggttagaaccctttgatggcggagaatat
tggtgcaacagcagtgccaaagtggtttatttaccccaacaaccagagatggacggcgat
cgcaccgtgttggagcaggtttttgtggacagtggcgaacagtggcaattagttaaacaa
tacgaactgctgtcggacaagttggcccaccagggcagtgacgagcaattgcttaatcaa
ctgtcggccctatcagcccagatggaaaccagtggggcctgggaattggaaacccaagcc
aaaattattctgacccagttgggggtagatcatctcgatgccaaagtaggcgatctttcc
ggtggttaccgtaaacgggtggcgatcgccgccgcattgttgtcccaaccggatgtgctg
ttgatggacgaacccactaaccatttggatgctttttcggtggaatggctacaaagttac
ctgcaacggttccggggagcattgttattaattacccacgaccgctattttttggaccgg
gtgacgaaccgtattttggaaattgaccaaggagaactgtatagctacaacggtaactat
ggttattatctgaccaaaaaagcggaagcagaggaatcggaacagagcagtcagaaaaaa
caccggggagtgttgcggcgggaattggaatggttaaaaagagggcctaaagcccggagc
actaagcaaaaagcccgcattgaccgcatccaggatatgcaggagaccagctttaaaacg
gggacgggaaaagtagatattagtacggctgggcggcgcattggcaaaaaagtggtagag
ctggaaaacattagcaagggctttgaaaacaaacaattaattaaagatttttcctatatt
ttcacccccggcgatcgggtgggaattgtgggcaaaaatggcgtgggcaaatccacttta
atgaatatgatcactggcagattggagccggaccaaggcacagtggacattggtagcacc
attcattttggttattttgatcaacactccgatgacctgagtttaaatcctaatcaacgg
gtaattgattacctcaaaagtgtggcggaattgatcaaaaccaccgacggcgaagtaatt
accgctgggcagatgttagaaagatttttatttccccccaatcaacaatttgctcccatt
gccaagttatccgggggagaaaagcgccgtttatttttactgcgggtgttgatgcgagcc
cccaacgttttaattttggacgaacctaccaacgatttggatgtgcaaaccctggcggtg
ttggaagattacctggaagattttaacggttgcgtcattgtggtttcccatgaccggtat
ttcctcgaccgcaccgtggaaaccatttttgcttttgaagaagagggagaactacggcaa
tatcccggcaattacactttgtatttggaatataaaaaagcagaacaggttagagcaaac
caagaagaaactgagttaaaaaaatctcaaccagttgcttctgttacgaccaaagttagc
caagatagtagctcgaaaaaactttcctataaagaaaagcgggaatacgaacagcttgag
caacaaattccccaattggaagaagaaaaagcccaactggaagcccaactttaccagagt
tccaacggcaattttaccgagttgcaaaacctgacggaacgcttagctaatttaagtgaa
agtattgatcaaaaaacagaacgttggctaactttagctgagagaatttga

DBGET integrated database retrieval system