KEGG   Synechocystis sp. PCC 6803: sll0913
Entry
sll0913           CDS       T00004                                 
Name
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Uma2
Other DBs
NCBI-ProteinID: BAA18410
CyanoBase: sll0913
UniProt: P74316
Position
complement(2014182..2014787)
AA seq 201 aa
MRIVTMLASSPITTLWEFLTLSHIEDSPAWEYVNGVITQKPMPQGQHSQLQYRLCQAINQ
VAEPLRLAYALPELRCTFADRSLVPDISVFRWQRIPLTTDGDIANHFTSCPDWIIEILSP
QQSATKVINNILYCLEQGSELGWLISPEERSILVFFPQYPPKFYGVEAAEMNNREELLPV
LNGLDLSLTTAEIFAWLKFVR
NT seq 606 nt   +upstreamnt  +downstreamnt
gtgagaatagttactatgcttgcctctagccccatcacaacgctatgggaatttctcacc
ctatcccacattgaagactctccggcgtgggaatatgtgaacggagttattactcaaaaa
cccatgccccagggacagcatagtcaattgcaataccgactttgccaggccattaaccaa
gtggccgagccccttcgcctcgcctatgctttgccggagttacgctgtacctttgctgat
cgttccctggtgccagatatttctgtatttcgttggcaaagaattcccttaactacggat
ggagatattgctaatcattttacgagttgccctgattggataattgagattctctccccc
cagcaaagcgcaacaaaggtaattaataatattctctattgcttagagcagggcagtgaa
ttggggtggctcatcagtccagaggaacgttcaattttagttttttttccccagtaccca
ccaaagttttacggtgttgaagctgcagagatgaacaatagggaagaactattgccagta
ttaaatggtttggacctcagcctaaccacagcggaaatttttgcttggctcaaatttgtc
cgttaa

DBGET integrated database retrieval system