KEGG   Synechocystis sp. PCC 6803: sll1127
Entry
sll1127           CDS       T00004                                 

Gene name
menB
Definition
(GenBank) naphthoate synthase
  KO
K01661  naphthoate synthase [EC:4.1.3.36]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00130  Ubiquinone and other terpenoid-quinone biosynthesis
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    sll1127 (menB)
Enzymes [BR:syn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.36  1,4-dihydroxy-2-naphthoyl-CoA synthase
     sll1127 (menB)
SSDB
Motif
Pfam: ECH_1 ECH_2 SDH_sah
Other DBs
NCBI-ProteinID: BAA17535
CyanoBase: sll1127
CYORF: sll1127
UniProt: P73495
Structure
PDB: 
4I4Z 4EML 4I52

Position
complement(1052927..1053754)
AA seq 275 aa
MDWHIAKHYDDILYYKAGGIAKIVINRPHKRNAFRPQTVFELYDAFCNAREDNRIGVVLL
TGAGPHSDGKYAFCSGGDQSVRGEGGYIDDQGTPRLNVLDLQRLIRSMPKVVIALVAGYA
IGGGHVLHLVCDLTIAADNAIFGQTGPKVGSFDGGFGSSYLARIVGQKKAREIWYLCRQY
SAQEAERMGMVNTVVPVDRLEEEGIQWAKEILSKSPLAIRCLKAAFNADCDGQAGLQELA
GNATLLYYMTEEGSEGKQAFLEKRPPDFSQYPWLP
NT seq 828 nt   +upstreamnt  +downstreamnt
atggattggcacattgcaaaacattacgacgacattctctattacaaagcgggggggatc
gccaaaattgtcatcaatcgtccccataaacgcaacgccttccgtccccagaccgttttt
gaactttatgacgcattttgtaacgccagggaagataaccgcatcggggttgtactacta
accggagccgggccccacagcgatggcaaatatgccttttgttccggtggggatcaatct
gtccggggagaagggggttatatcgacgaccaaggaactccccgcctcaatgtgctcgat
ttacagcggttaatccgctccatgcccaaagttgtcattgccctagtggctggctatgcc
attggtggtggccacgttttacatttggtgtgtgacctgaccattgccgcagataacgcc
attttcggccaaaccgggccaaaagtggggagttttgatggaggctttggctccagttac
ttagctcgcattgtgggacaaaaaaaagccagggaaatttggtatctttgccgccaatac
tctgcccaggaagcagaacgcatgggcatggtgaacaccgttgttcccgtcgatcgcctg
gaggaagaaggtatccaatgggcgaaggaaatcttgagcaaaagtcccctggctatccgc
tgtcttaaagctgctttcaatgccgactgtgacggccaggctggattacaggaactagcg
ggcaacgccaccttgctttattacatgacagaagagggcagtgaaggcaaacaagccttc
ctggaaaaacgccccccggattttagccaatatccctggctcccctaa

DBGET integrated database retrieval system