KEGG   Synechocystis sp. PCC 6803: sll1129
Entry
sll1129           CDS       T00004                                 

Gene name
todF
Definition
(GenBank) 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr UPF0227 Abhydrolase_2 Thioesterase Esterase
Other DBs
NCBI-ProteinID: BAA17530
CyanoBase: sll1129
CYORF: sll1129
UniProt: P73490
Position
complement(1049517..1050407)
AA seq 296 aa
MTPSLTLPAPAFTEATSWECWRQMQQVSLTIHGPDHPSAITVDTNYMDEGQGEPMLFIHG
FDSSVLEFRRLLPLIKKNFRAIAIDLLGFGFTTRSKILLPTPANIKIHLDHFWQTIIQEP
ITLVGVSMGGAVALDFCLSFPERVKKLVLIDSAGLAKQPFASRLMFPPLDRWLTNFLASP
QVRQSIGQTAYYNRSLASEDARLCAAAHLTCPGWSEGLIAFSKSGGYGSFAEQLGQITLP
SLIIWGKQDKILGVRAAERFQNLLPQSQLIWLDACGHVPHLEQPEATAAALRQFCL
NT seq 891 nt   +upstreamnt  +downstreamnt
atgactccttccctaacccttcccgcaccggcatttactgaagcaacctcctgggaatgt
tggcgacaaatgcaacaagtttccctaaccatccatggcccagaccaccccagtgccatc
accgtggacaccaactatatggatgaaggccagggggaacccatgctttttatacatggc
tttgacagttcggtgttggagtttcgtcgcctactgcccctaatcaaaaaaaattttcgg
gcgatcgccattgatttgctgggatttggtttcacaactagatccaagatattactaccc
accccagccaacatcaaaattcacctagaccacttttggcaaacaattattcaagaaccc
attaccttagtgggggtatccatggggggagcagtggccctagatttttgcctcagcttt
cccgaacgggtcaaaaaactagtgctaatagatagtgctggcctcgcgaaacaacccttt
gccagtcggctcatgtttccaccgttggaccgttggctaaccaattttttagccagccca
caggtcagacaaagtattggccagaccgcctattacaaccggagtctagccagtgaagat
gcccgcctctgtgccgctgcccatttaacctgcccgggttggagcgaaggattgattgcc
ttcagcaaaagtggtggttatggctcctttgccgagcaattggggcaaattactttgcct
agcctaattatttggggtaaacaggacaaaattttgggtgttagagcggctgaacgattc
caaaatcttttgccccagagtcaattaatctggcttgatgcctgtggccatgtgccccat
ctggaacaacccgaagctaccgccgccgccctcagacaattttgcctatga

DBGET integrated database retrieval system