KEGG   Synechocystis sp. PCC 6803: sll1131
Entry
sll1131           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: GtrA DUF1290 DUF3043
Other DBs
NCBI-ProteinID: BAA17526
CyanoBase: sll1131
CYORF: sll1131
UniProt: P73486
Position
complement(1046402..1046830)
AA seq 142 aa
MITRETLPVYLQRLWQNAMVRWWIIGIIAMVLNVVLLDWFKVSLGMGLTWASVLSAEVIT
IIRYGAIDLWVFRNPNLSWQRCWEYHVANFSGFFLWSLIIVILGNKLGWDHKIAAIVATM
ITVFWSMATNFLWVWRKPKKKA
NT seq 429 nt   +upstreamnt  +downstreamnt
atgattaccagggaaaccttgcccgtttatttacaacgcctttggcaaaacgccatggtg
cgctggtggatcattggcattattgccatggttttgaacgttgtcctcttggattggttc
aaagtgtccctcggcatgggcctcacctgggcttccgtcctctccgccgaagtcattacc
atcattcgttacggggcgattgacctctgggtatttcgtaatcctaacctttcttggcaa
cgctgttgggaataccatgtggccaatttcagtggcttttttctctggagtttaattatt
gtaattttgggcaataaattgggctgggaccataaaatagcggctatcgttgccaccatg
attaccgtattttggagcatggccactaactttctttgggtctggcgtaaaccgaaaaag
aaagcttaa

DBGET integrated database retrieval system