KEGG   Synechocystis sp. PCC 6803: sll1138
Entry
sll1138           CDS       T00004                                 

Definition
(GenBank) unknown protein
  KO
K01838  beta-phosphoglucomutase [EC:5.4.2.6]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    sll1138
Enzymes [BR:syn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.6  beta-phosphoglucomutase
     sll1138
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Other DBs
NCBI-ProteinID: BAA17510
CyanoBase: sll1138
CYORF: sll1138
UniProt: P73470
Position
complement(1029337..1030083)
AA seq 248 aa
MLKAVLLDFNGVVINDEAIHRSLIDELLLTENLRPLTPAEYQQFCLGRSDRACLVDLFEH
RGRGLTEAYLQKLIDRKAESYHQKLVALETLPIYGGLKEFLEKLQLRRLAIALVTGAVRS
EVEYGLDRAGLARYFPVIVAGDDIASSKPQPDGYQLAIHKLNQWRQSQAVTDSLLDDIAP
LLPENCLAIEDTFAGIEAAKKAGMAVVGIAHTYPYHFMQRQANWAVDRFDELDLDRLQVI
FSRPKLAV
NT seq 747 nt   +upstreamnt  +downstreamnt
atgttaaaggcagtattgttagacttcaatggcgtggtaatcaacgatgaagcgatccat
cgcagtctgattgacgagctattgttgactgagaatttgcgtcccctcactccagcggag
taccaacagttttgtttgggccgcagtgaccgggcttgtttggtggatttgtttgagcat
cggggccgggggttaacggaagcctatttgcaaaagctaattgaccgcaaagcggagagc
taccatcaaaaactggtggccctggaaaccctgcccatctatggcggactgaaggagttt
ctcgaaaagttgcagttacgacgattggcgatcgccttggtgacgggggccgttaggtca
gaggtggaatacggattagaccgggctgggctagcaaggtactttccagtcattgtggcg
ggggatgatattgccagcagtaaaccccagccggatggctatcaactggctattcacaaa
ctcaatcaatggcggcagagccaagcggtgaccgatagcttgctcgatgacatcgctccc
ctgttaccggaaaattgtctggcgatcgaagatacctttgccggcattgaagcggcgaaa
aaagccggtatggccgtggttggcattgcccatacctatccctatcactttatgcaaagg
caagctaactgggcagtggaccgttttgatgagttggatctagaccgtttacaggtgatt
ttttcccggcccaaactggcagtgtga

DBGET integrated database retrieval system