KEGG   Synechocystis sp. PCC 6803: sll1142
Entry
sll1142           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K08999  uncharacterized protein
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    sll1142
SSDB
Motif
Pfam: DUF151
Other DBs
NCBI-ProteinID: BAA17506
CyanoBase: sll1142
CYORF: sll1142
UniProt: P73466
Position
complement(1024825..1025346)
AA seq 173 aa
MIEMRVAGIALDAVSRSPIVLLKDGSERRALPIYISQDQARSIIGALENQKPTRPLTHDL
MVNLLTTWDVDLKKIIIHSLQDNTFYAVLCCAQGDQIREIDCRPSDAISLALRMDSPIWV
MEEVLADASIPVDRDADEEERQAFRDFLDNVSPETLIKQARLSSDSFEAESDS
NT seq 522 nt   +upstreamnt  +downstreamnt
atgattgagatgagagtagctggcattgccctcgatgcggtaagtcgcagtcccatcgta
ttgctcaaggatggatctgaacggcgggcattacccatttatatcagccaagaccaagct
cggtcgattatcggagccctggaaaatcaaaagcccacccgtcccctcacccatgacctg
atggtcaatctcctcaccacctgggatgtggacctcaaaaaaattattattcattccctg
caggataataccttttacgctgtgctctgttgtgcccagggggatcaaattagggaaatt
gactgccgccccagtgatgccatttccctcgcgttgcggatggacagtcccatttgggtg
atggaagaagtgttggccgatgcttccattcccgtggatcgagatgcggacgaagaagaa
agacaagcttttcgggattttctcgacaatgttagcccggaaaccctgatcaaacaggct
cgcctaagttccgatagctttgaggcggaatccgatagttag

DBGET integrated database retrieval system