KEGG   Synechocystis sp. PCC 6803: sll1223Help
Entry
sll1223           CDS       T00004                                 

Gene name
hoxU
Definition
(GenBank) hydrogenase subunit
  KO
K05588  bidirectional [NiFe] hydrogenase diaphorase subunit [EC:1.6.5.3]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00190  Oxidative phosphorylation
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    sll1223 (hoxU)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     sll1223 (hoxU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_4 NADH-G_4Fe-4S_3 Fer4_6 Fer4 Fer4_9 Fer4_10 Fer4_7 Fer4_16 Fer4_8 Fer4_15 Fer4_2 Fer4_4 Fer4_21 Fer4_13 Fer4_17 Fer4_3 Fer4_22
Motif
Other DBs
NCBI-ProteinID: BAA18095
CyanoBase: sll1223
CYORF: sll1223
UniProt: P74022
Position
complement(1674944..1675660)
Genome map
AA seq 238 aa AA seqDB search
MSVVTLTIDDKAIAIEEGASILQAAKEAGVPIPTLCHLEGISEAAACRLCMVEVEGTNKL
MPACVTAVSEEMVVHTNTEKLQNYRRMTVELLFSEGNHVCAICVANGNCELQDMAITVGM
DHSRFKYQFPKREVDLSHPMFGIDHNRCILCTRCVRVCDEIEGAHVWDVAYRGAECKIVS
GLNQPWGTVDACTSCGKCVDACPTGSIFHKGETTAEKIGDRRKVEFLATARKEKEWVR
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgttactttaaccattgatgataaggcgatcgccattgaagaaggcgcaagt
attttgcaagcggctaaagaagcaggggttcccattcccaccctttgccatttagaaggg
atttcagaagcggcagcctgtcgtttgtgcatggtggaagtggaaggcacgaataaattg
atgcccgcctgcgttaccgctgtgagcgaagaaatggtagtccacaccaacacagaaaaa
ttgcaaaattaccgacgtatgacagtggaattacttttttccgaaggcaatcatgtctgt
gccatttgtgtggctaacggcaactgtgaattgcaagatatggccattacggtgggtatg
gatcacagccgatttaaatatcaatttcccaagcgagaagtggatttatcccatcccatg
tttggcattgatcataaccgttgtattctctgtacccgttgtgtgcgagtttgcgatgaa
attgagggagcccacgtttgggatgtggcttaccggggcgcagaatgcaaaattgtttct
ggtttaaatcagccctggggaaccgttgatgcctgtacttcctgtggcaaatgtgtggat
gcctgtcccacgggttctatcttccataaaggagaaactactgctgaaaaaattggcgat
cgccgtaaggtggagtttttagccactgcccgtaaagaaaaggaatgggtcaggtag

DBGET integrated database retrieval system