KEGG   Synechocystis sp. PCC 6803: sll1270Help
Entry
sll1270           CDS       T00004                                 

Gene name
glnH_glnP
Definition
(GenBank) glutamine-binding periplasmic protein/glutamine transport system permease protein
  KO
K17062  arginine/lysine/histidine/glutamine transport system substrate-binding and permease protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:syn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    sll1270 (glnH_glnP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    sll1270 (glnH_glnP)
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/lysine/histidine/glutamine transporter
    sll1270 (glnH_glnP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 BPD_transp_1 Lig_chan-Glu_bd NMT1 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: BAA17584
CyanoBase: sll1270
CYORF: sll1270
UniProt: P73544
Position
complement(1114429..1116021)
Genome map
AA seq 530 aa AA seqDB search
MKGMVKLGHWGKTWRYYLLLALGVLLAIAIPLLPAFSQVSRQTIIVATEPTFPPFEMTDE
ATGQLTGFDVDLIQAIGEAAQVTVDIQGYPFDGIIPALQSNTVGAAISAITITPERAQSV
SFSSPYFKSVLAIAVQDGNDTIKNLKDLEGKRLAVAIGTTGAMVATNVPGAKVTNFDSIT
SALQELVNGNADAVINDRPVLLYAIKDAGLRNVKISADVGSEDYYGIAMPLAPPGEINQT
REVLNQGLFQIIENGTYNAIYEKWFGEKNPPFLPLVAPSLVGKVGTAQSLTERSQANPND
NFLITLFRNLFKGSILTVLLTAFSVFFGLIGGTGVAIALISDIKPLQLIFRIYVEFFRGT
PMLVQLFIIYFGLPALFKEIGLGITIDRFPAAIIALSLNVAAYLAEIIRGGIQSIDQGQW
EACESLGMSPWQTMKEVIFPQAFRRILPPLGNEFITLIKDTSLTAVIGFQELFREGQLIV
ATTYRAFEVYIAVALVYLLLTTISSFVFKWLENYMDPIGRAKKKAKAATA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggcatggttaaactgggccattggggtaaaacctggcgttattatctgttgctg
gctttgggagtactgttggcgatcgccataccgttattaccggccttttcccaggtttcc
cgccaaaccatcattgtggccacggaacccacctttcctccttttgaaatgaccgatgaa
gccacggggcaattaaccggttttgatgtggatttgattcaggcgatcggagaagcggcc
caggtcaccgttgatattcagggctatcccttcgacggcattatccccgccttgcaatcc
aatacggtgggggcggccatcagtgccattaccattaccccagagcgggcccagtcggtg
tccttttccagtccctattttaaatcggtgctggcgatcgccgtgcaggatggcaacgac
accatcaaaaacctgaaggatttggaggggaaaagattagcggtggcgatcggtaccact
ggggcgatggtagcgactaacgtacctggggctaaagttaccaactttgattccattacc
tctgctctccaggaattggtcaacgggaacgccgatgcagtgatcaatgaccgcccagta
ttgctctacgccatcaaagacgcaggtttgagaaacgtcaaaattagtgccgatgttggc
agtgaagattattacggcattgccatgcccctggctcctcctggggaaattaatcaaact
agggaagtgctcaaccaaggtttattccaaattattgaaaatggcacctataacgccatc
tatgaaaaatggtttggcgaaaaaaatcccccctttctccccctagtagccccttccctg
gtgggtaaagtgggcacggcccagagcctgaccgaacgcagtcaagctaaccccaacgat
aactttctcatcaccctgttccgcaatctctttaaaggttccatactcaccgttctcctc
accgccttttccgttttctttggtttaatcggtggcaccggagtggcgatcgccttgatt
tccgatattaagcctctacaactgatatttcgcatctacgtggagtttttccgcggtact
cccatgttggtgcaactattcatcatctacttcggtttgccggcgctgttcaaggaaatt
ggcttgggcatcaccattgaccggttcccggcggccattattgccctcagtttgaatgtg
gccgcttatctagcagaaattattcgaggtggtatccaatccattgatcagggccagtgg
gaggcctgtgaatcccttggtatgtccccttggcagactatgaaggaagtaatttttccc
caagcttttcgccgtattttgccgcccctgggtaacgaatttatcaccctaattaaagac
accagtttaaccgccgtgattggcttccaggaactattccgggaagggcagttaattgtg
gccaccacctatcgagcatttgaagtgtacattgctgtcgctctggtgtacttacttctc
accaccatttcttccttcgtcttcaaatggctagaaaattacatggaccccattggccgg
gccaagaaaaaagctaaagcagcgacggcttag

DBGET integrated database retrieval system