KEGG   Synechocystis sp. PCC 6803: sll1274
Entry
sll1274           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF2396 zf-WRNIP1_ubi
Other DBs
NCBI-ProteinID: BAA17576
CyanoBase: sll1274
CYORF: sll1274
UniProt: P73536
Position
complement(1105030..1105545)
AA seq 171 aa
MQNLGLQYPLFGPEIQCPHCRQTIPALTLTDTYLCNRHGAFEVNPDTEDLVHLQSGRHWR
LWQGEWYRQHTHPDGIRFEIHEALDRLYTEGYRATKVIIAHRYYDLVSVYLQRQGSWRNP
EDKDSPLPRLYGLPVEFSAPGTADDCWQVINFDLEKEKGIPKRYPYFRLFD
NT seq 516 nt   +upstreamnt  +downstreamnt
atgcaaaatctcggtttacagtatccccttttcggcccagaaatccagtgcccccactgt
cggcaaactattccggccttgaccctgacggacacttacctttgtaatcgccatggagcc
tttgaagttaaccccgacacagaggatttagtccatttgcaatcgggtcgccactggcgg
ctatggcagggggaatggtaccggcaacacacccaccccgacggtatccgctttgaaatt
cacgaagccttggaccggctctacacggaaggttaccgggccaccaaggtcatcatcgcc
caccgttactacgatctagtcagcgtttatctgcaacggcaaggtagctggcgcaatccc
gaagataaggatagtcctctgcctcgtctttacggtttaccagtggaattcagtgcccca
ggtacagcggacgattgttggcaggtaattaactttgatctggaaaaggaaaagggtatt
cccaagcgctatccctatttccgtttatttgattag

DBGET integrated database retrieval system