KEGG   Synechocystis sp. PCC 6803: sll1280
Entry
sll1280           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M56
Other DBs
NCBI-ProteinID: BAA17569
CyanoBase: sll1280
CYORF: sll1280
UniProt: P73529
Position
complement(1095772..1096683)
AA seq 303 aa
MKLGRILKMSEFMSNSIPLVGLKADHFRHPLDQMATTNLKQIPGLDLMVRGLLGSVAEQF
FALNNLAASVRVGEKQLPHLHQLLLDACKILDLEAPELYIQQNPQPNAYTFAMRGKKPFM
VMHTSLVDMLTPAEIQAVMAHELGHLKCEHGVYLTLANIMVLAAGLIPNWGAVLTQSLQS
QMLEWVRCAEFSCDRAALLAVQDPKVVMSVLMKLAGGSPQLAPLLNLDAFIDQAREYDRL
GEDEMGAMLRNMQTQNLTHPVPVLRAREIDRWSDSQTYQNLLKGRKNAYNLNTEENKGGW
RNW
NT seq 912 nt   +upstreamnt  +downstreamnt
gtgaagttaggccgaattttaaaaatgtcagaattcatgagcaactccattcccctggtg
ggattaaaggcagaccatttccgccatcctttggaccaaatggccaccaccaacttgaag
caaattcccggcctagacctgatggtgcggggactgttgggctccgtggcagaacagttt
tttgccctcaataatttggcggccagtgtccgggtgggagaaaaacaattaccccatctt
catcaactgcttttggatgcttgcaaaattctcgacctggaagcgccggaactctacatt
caacaaaatccccaacccaatgcctacacttttgccatgcgaggtaaaaagcctttcatg
gtgatgcacacttccctggtggatatgttgactccggcggaaattcaagcggtgatggcc
catgagttgggacacctcaaatgtgaacatggggtgtatttaaccctggctaacattatg
gtcttagcagcggggctaattcccaactggggagcagtgttgacccaatccctccagtcc
cagatgttggagtgggtgcgctgtgctgaatttagctgtgaccgggcagccctgttggcg
gtgcaagacccgaaagtggtgatgtcggtgctgatgaagttggccggtggttctccccaa
ttggctcctttactaaacttggatgctttcattgaccaagcccgggaatacgatcgcctg
ggggaagatgaaatgggggcaatgctgaggaatatgcagacccaaaacctgacccatccg
gtgccggtactccgggccagggaaattgatcgttggagtgattcccaaacctatcaaaac
ttgctcaagggccgcaaaaatgcgtataatctgaacaccgaagaaaacaagggcggctgg
cggaattggtag

DBGET integrated database retrieval system